SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004029 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004029
Domain Number 1 Region: 2-397
Classification Level Classification E-value
Superfamily Thiolase-like 3.2e-74
Family Thiolase-related 0.0033
Further Details:      
 
Domain Number 2 Region: 2207-2483
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.25e-61
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.00000000138
Further Details:      
 
Domain Number 3 Region: 1626-1787
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.18e-40
Family Alcohol dehydrogenase-like, C-terminal domain 0.00012
Further Details:      
 
Domain Number 4 Region: 485-609,672-768
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.63e-40
Family FabD-like 0.0039
Further Details:      
 
Domain Number 5 Region: 1870-2059
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.93e-35
Family Tyrosine-dependent oxidoreductases 0.00018
Further Details:      
 
Domain Number 6 Region: 1545-1661
Classification Level Classification E-value
Superfamily GroES-like 3.67e-16
Family Alcohol dehydrogenase-like, N-terminal domain 0.0043
Further Details:      
 
Domain Number 7 Region: 2112-2175
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000131
Family Acyl-carrier protein (ACP) 0.00019
Further Details:      
 
Domain Number 8 Region: 1229-1386
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000258
Family Plant O-methyltransferase, C-terminal domain 0.09
Further Details:      
 
Domain Number 9 Region: 609-665
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000119
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004029   Gene: ENSDORG00000004306   Transcript: ENSDORT00000004311
Sequence length 2493
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_25162:2868:16697:-1 gene:ENSDORG00000004306 transcript:ENSDORT00000004311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLEEFWANLIGGVDMITEDDRRWKAGLYGLPRRSGKLKDISKF
DASFFGVHPKQAHTMDPQLRLLLEVAYEAIVDGGINPAWLRGTHTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSTAIDTACSSSLLALQSAYQAIRSGEC
PAALVGGINLMLKPNTSVQFMKLGMLSPEGTCKSFDAEGNGYCRSEAVVAMLLLKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGEVQEQLLRSMYLPAGLDPKALEYIEAHGTGTKVG
DPQELNGIDEALCTSRKDPLLIGSTKSNMGHPEPASGLAALAKVLLSGHLWAPNHFHNPP
AIPALRDGRLQVDLPVRGGLVSINSFGFGGCNVHVILQPNTQRPPEPAPHAALPRLLQAS
GRTPEAVQSLLDQGRRHSQDLAFLSMLNDIAATAPTAMPFRGYAVLGVEGGSQEVQQVST
GRRPLWFICSGMGTQWRGMGLSLMRLDSFRDSILRSDEALKPLGVKVSELLSNQENSFDD
IVHAFVSLTAIQIALIDLLTSVGLKPDGIVGHSLGEVACGYADGCLSQEEAVLCAYWRGQ
CIKEAKLPSGSMAAVGLSWEECKQRCPPGVVPACHNSEDTVTVSGPQASVSKFVEQLKQD
GVFAKEVRTGGIAFHSYYMESIAPTLLQALKKVIRSPRPRSVRWLSTSIPEAQWGSSLAQ
TSSAEYNVNNLVSPVLFQEALRHIPEHAVVLEIASHALLQAVLKRGVKTSCTIIPLMKKD
HRDNLEFLLTNLGKLHLTGIDVNPNGLFPPMELPAPRGTPLISPSIKWDHSQTWDVPAAT
DFPSGNSSSSATIYNMDTSPESTDHYLVDHRIDGRVLFPATGYLYLVWRTLARSLSLTLE
QTPVVFENVTLHQATILPKTGTVSLEVRLLEASHTFEVSDSGNLIVSGKVYLWENPDPTL
FDHPEGLEPAEPASAPRLTQADVYKTLRLRGYDYGPQFQGILDASLEGSSGKLLWKDNWV
TFLDTMLQVSILGLSRRSLHLPTRFTAIHIDPATHLRKLYTLQGQTQVADVVVNHCLSST
VAGGAHISRLHTSAAPRRQQDQLTPTLETFCFTPHVEPGCLWESGTLQEELRLCMGLTKA
LQIKAAQQGLKMVVPGLDGAQALREPSPQGLPRLLAAACQLQLNGNLQLGLAQALGQERA
LLPEDPLLCGLLDSRALKACVDTAMENLPSLKMKVVEVLAGEGRLYSRIPALLNTQPMLQ
LDYTATDPLPQALELQQRDVAQSQWDPTSPAPSHLGAADLLLCNCAGAGSPALALGHMAA
ALKEGGFLLLHTLLRGHALGETLAFLSSEPQDGPCLLSQEEWEGLFSKTSLRLVGLKKSF
YGTALFLCRRPAPQDSPILLSVEDPGFQWVESLKNILAESSPRPVWLTATDCPTSGVVGL
VNCLRKEPGGHRIRCVLLSNLSPASRVPTLDPGSPELQQLLASDLVMNVYRDGVWGAFRH
FPLEQDKPEEQTAHAFVNVLTRGDLASIRWVCSPLRHAAPAGTGPEGTQLCTVYYAALNF
RDIMLATGKLSPDAIPGKWAARDCMLGMEFSGRDARGQRVMGLVPAEGLATSVLLSPDFL
WDVPSGWTLEEAASVPVVYATAYYALVVRGRVRRGESVLIHSGSGGVGQAAIAIALSVGC
RVFTTVGSAEKRAYLRTRFPQLDDASFANSRDTSFEQHVLRHTGGKGVDLVLNSLAEEKL
QASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDALFEEASPDWREVSAL
LQAGIREGVVRPLKRTVFPKAQVEDAFRYMAQGRHIGKVLIQVREEEQEALLPGVQPVMM
SAIAKTFCPPHKSYVITGGLGGFGLELAQWLVQRGAQRLVLTSRSGIRTGYQAKQVCEWR
RQGVQVLVSTHDASSLEGARALIAEAAQLGPVGGVFNLAMVLRDAMLENQTPELFQDVNK
PKYSGTLHLDRVTREACPELDYFVAFSSVSCGRGNAGQTNYGFANSTMERICEQRRHDGF
PGLAVQWGAIGDVGIVLEAMGTNDTVIGGTLPQRMTSCMEVLDLFLNQPHAVLSSFVLAE
KVVSRADSAGQRDLVKAVAHILGIRDLASINLSSSLADLGLDSLMGVEVRQTLEREYDLV
LSMREVRQLTLQELKELSSPSPEPVDLKPKEESSSWNRDLLSTLLVNPGGPTLTRLNAVQ
SAERPLFLIHAIEGSTTVFHGLAAKLSVPTYGLQCTQAAPLDSIYDLAAYYLGHMKQVQP
EGPYRVAGYSYGACVAFEICSQLQAQQGSAPTHNSLFLLDGSPAYVLAYTQSYRAKMTLG
CEAEAEAEALCFFVQQFIDTDHKTLLEALLPLKDLDARVAAAVDLITRSHQNLSCHELSF
AAKSFYHKLHALELYQPKAKYQGSVTLLRAKTGGACGEDLGADYNLSQVCDGKVSVHVIE
GDHRTILEGQGLESIVSIIHSSLAEPRVSVREG
Download sequence
Identical sequences ENSDORP00000004029 ENSDORP00000004029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]