SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004115 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004115
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.93e-62
Family Alanine racemase-like, N-terminal domain 0.000000135
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.19e-34
Family Eukaryotic ODC-like 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004115   Gene: ENSDORG00000004402   Transcript: ENSDORT00000004402
Sequence length 448
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_11309:12213:22960:-1 gene:ENSDORG00000004402 transcript:ENSDORT00000004402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIYISPCKQISQI
KYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEENIGGEEGNMKFGTTLKNCRHL
LECAKELAVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGELGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGIKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSS
GVEETRSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFPRPAIYYMMSFSDWYEMQDAGI
TSDTMMKNFFFAPSCIQLSQEDSFSTEA
Download sequence
Identical sequences A0A1S3EX13
ENSDORP00000004115 ENSDORP00000004115 XP_012867970.1.60039 XP_012867972.1.60039 XP_012867973.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]