SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004120 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004120
Domain Number 1 Region: 42-192
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.79e-34
Family Alanine racemase-like, N-terminal domain 0.0000032
Further Details:      
 
Domain Number 2 Region: 253-409
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1e-25
Family Eukaryotic ODC-like 0.0000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004120   Gene: ENSDORG00000004407   Transcript: ENSDORT00000004407
Sequence length 474
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_15:67509:96345:1 gene:ENSDORG00000004407 transcript:ENSDORT00000004407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYLSESDFVMEEGFSTRDLLELTLGASLATTDKVAAFFVADLGAVVRKHFCFLKCLPRV
RPFYAVKCNSSLGVLKVLAELGLGFSCANKAEMELVQRIGVPASKIIYTSPCKQIAQIRY
AAEHGVQLLSFDNEMELAKVVRSHPSAKMVLCIATDDSRSLSCLSLKFGAPLSCRHLLEN
AKKSHMEVVGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXIGSVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIIAKKEILLDQPGR
EALLPAPHSACTPPVTSFPAEENGSTPKTVVYHLDEGVYGIFNSVLFDNICPTPILQKKP
AAKQPLYSSSLWGPAADSHDCVAEGLWLPQLHVGDWLVFDNMGAYTVGTGSLQGTQACRI
TYAMSRVAWEALRGQLLPTEEDQDAEGVCKPLSCGWEITDTLCVGPAFTPASIM
Download sequence
Identical sequences ENSDORP00000004120 ENSDORP00000004120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]