SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004281 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004281
Domain Number 1 Region: 970-1269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-66
Family Protein kinases, catalytic subunit 0.0000434
Further Details:      
 
Domain Number 2 Region: 125-224
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000391
Family N-terminal PAS domain of Pas kinase 0.00000864
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004281
Domain Number - Region: 341-380
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0227
Family Heme-binding PAS domain 0.033
Further Details:      
 
Domain Number - Region: 235-304
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0305
Family Heme-binding PAS domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004281   Gene: ENSDORG00000004572   Transcript: ENSDORT00000004573
Sequence length 1296
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1983:1740:33736:-1 gene:ENSDORG00000004572 transcript:ENSDORT00000004573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRGPPAFDEDQRMLSRSLPVLESSTAQTTSEPSKPLSSARRHLSRKNLSLQSRALPED
RWSSYCLSSLAAQNICTSKLYCSTAPEHADLAGSMASTSCCSLLKGLSSGWSAPLLPAYV
YNPNKAVFTVDAKTTEILVANDNACRLLGYSSHDLIGQKLMQFFLKSDSDVMEALSEEHV
EADGHAAVVFGTVVDIVSRTGEKIPVSVWMKRMQQERGLCCVVVLEPVERIAAWVSFQSD
GTVAACDSHFAHLHGFASGEDVLGQHITDLIPSIQLPPPGQQVPKSLKIQRSVGKARDGT
TFPLSLKLKSKPSSEAAAEGAAAQGLGYQASVWVFCTISGLITLLPDGTIYGINHSFALM
LFGYGKMELLGKNITFLIPAFYHYMDFACDSSIYLPDLTNESGPAEPGWGLASGARXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRCLSSIPGGG
PPVHTEQSLPAEQCIPVPGKENPGVAESPRQTLSGESRSPPADAKLFASRADSEPLLLAE
DRNSSMDLCGLRQEAQWELLGISNPSSPAWADATMPEPHAAGQPAGGGFPMHCPRYASEW
VMQQRAQDLVPSSPGMAGVSLGTPTLDEQWLGVKNDREELQTCLIKEQLSKSSFSGTLGI
SYVELVPAEHPPFATPVSFCDLGGTDLRSSHLGSSSACYALATDLPGVLETMESQEDDVN
SYSWNLKELFLSDQTEQASSNCSYATSELSETPSPSVVGSDLDMGGLRRHNPDPLGDREL
LLLTGTYFNLSEGRQDPQSLEPPEVSLKPSKYYKASDLESSACILAIPDTSPEAECPAVG
EPGLSTQVTSTPMTRRAASLQREIQEGTYSGSCFHRDGLRLSIQFEVKRVELQGSATLFC
CWLVKDLLHSHQDSATRTRLLLASLPGSTHSTDISPSSPGEVLRTKPWFEEPPMPAELEG
LAACEGEYSHKYHTLSPLGSGAFGFVWTAMDKEQNKEVVVKFIKKEKVLEDCWIEDPKLG
RVTLEIAILSRVEHVNIIKVLDVFENQGFFQLVMEKHGSGLDLFAFIDHHPNLDEPLASY
IFRQVRADQSHLVSAVGYLRAQGIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFY
TFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLIFEENPFCEVEETMEATLRPPYLV
SQELMNLVSGLLQPAPEKRTTLEKLVQDPWLTQPVNLADYTWEEVCRISKPEPHHLCTPS
LEVGCRSPSQGPREGCPAPSGGQHSLGPEEPSPPVG
Download sequence
Identical sequences ENSDORP00000004281 ENSDORP00000004281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]