SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004628 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004628
Domain Number 1 Region: 435-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000603
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 614-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000765
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004628
Domain Number - Region: 679-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000943
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 471-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 742-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00198
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 774-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00524
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 647-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0104
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 145-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0806
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004628   Gene: ENSDORG00000004944   Transcript: ENSDORT00000004944
Sequence length 842
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3736:4701:36538:-1 gene:ENSDORG00000004944 transcript:ENSDORT00000004944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKWNQLHRWKRQNVNEFLLSLAFQSHNQMNLEKFSYFFPEDHVEDAHLEFVPSWPTPSGL
TKSSTLALCQQTLANSSIGRLCLAFLGKRLDQAIDMCIKDVLLKDDASWAEASLALLENE
CEKRVSEERKWNKEELEDVLLVLKCPGLCSGNGQCMEWGCVCFPGFSSYDCSKLYDKTPE
ITELENAGFCDVQRYNCVMVRVFGEDFKTSIKCEVTKLQYNGHKWVLGESISVQTIFQNN
RTVDCHLPTEVQQANTMDLMGENSVVKWQLKVSNDGYKYSNPKVLVIYNGTCQICGPYEN
DSCTMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQPPMIQSLQDKIQT
FYGENFEYQIMALDLEGSEIHFTLDSGPEGASISSAGLLTWKAEAQIPPPFSIRLQDDCG
AEANVNIQVAVKSCDCLNGGLCESDRSFPPGSGAYLCVCLPGFQGGRCEEDVSQCQSNPC
GLGRCHRGFESYSCECPPEFKVETHLLNEITTQTMVVTRSDKSLIKEKDSEISKQRESYV
QPTNGYRSTICRHPCGKDRECVAPNTCRCKAGYVGSNCQTAICHPACKNHGKCVKPHICE
CPPGYGGATCTEEHCNPPCQHGGTCLSGNLCTCAYGFVGPRCETKVCNRHCENAGECLEP
DVCQCKPGWYGPTCNTALCEPICLNGGSCYKPNTCLCPNGFFGAQCQNAICHPPCKNGGL
CLRDNVCVCRRGYTKRCQKSICDPMCMNGGRCVRPNICSCPSGWSGKRCSRPTCFQKCKN
GGDCIAPGVCHCPSAWEGEQCQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIK
HH
Download sequence
Identical sequences ENSDORP00000004628 ENSDORP00000004628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]