SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004746 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004746
Domain Number 1 Region: 698-913
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-107
Family Thrombospondin C-terminal domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 571-696
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.1e-35
Family TSP type-3 repeat 0.00000517
Further Details:      
 
Domain Number 3 Region: 187-232
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.7e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00094
Further Details:      
 
Domain Number 4 Region: 491-573
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.27e-17
Family TSP type-3 repeat 0.00012
Further Details:      
 
Domain Number 5 Region: 13-124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000105
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 6 Region: 342-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000694
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 260-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000326
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004746
Domain Number - Region: 399-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00318
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004746   Gene: ENSDORG00000005073   Transcript: ENSDORT00000005072
Sequence length 931
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1852:4555:42824:1 gene:ENSDORG00000005073 transcript:ENSDORT00000005072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDLLPTSSQRLNPAALQPVLTDPALNELYLISTFKLQTKSSATIFGLYSSSDNSKYFEFT
VMGRLNKAILRYLKDDGKIYLVVFNNLQLADGKRHRILLRLTNLQRGTGSVELYVDCTQV
DSIQNLPRAFSGLSQNPESIELRTFQRKAQDFLEELKLVVQGSLFQAASLQDCFLQQSEP
LATTSTGDFNRQFLGQMTQLNQLLAEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPT
PNTLVPPAPPAPPTRPPRRCDSNPCFRGVRCTDTRDGFQCGPCPEGYTGNGIVCSDVDEC
KYHPCYPGVRCVNLAPGFRCDACPVGFTGPMVQGVGINYAKSNKQMCTDVDECRNGACVL
NSICINTLGSYRCGPCKPGYTGDQTRGCKTERNCRNPELNPCSVNAQCIEERQGDVTCVC
GVGWAGDGYVCGKDVDIDSYPDEELPCSARNCKKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDNCVLTHNVDQRNSDKDIFGDACDNCRTVLNNDQRDTDGDGKGDACDDDM
DGDGIKNILDNCPKVPNRDQRDKDGDGVGDACDSCPDISNPNQSDVDNDLVGDSCDTNQD
SDGDGHQDSTDNCPTVINSSQLDTDKDGIGDECDDDDDNDGIPDVVPPGPDNCRLVPNPA
QEDSNRDGVGDICESDFDQDHVIDRIDVCPENAEITLTDFRAYQTVVLDPEGDAQIDPNW
VVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYV
VMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDS
RNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQEN
IIWSNLKYRCNDTIPEDFQEFQTQNFDRLDN
Download sequence
Identical sequences ENSDORP00000004746 ENSDORP00000004746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]