SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004886 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004886
Domain Number 1 Region: 27-408
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-108
Family ALDH-like 0.00000349
Further Details:      
 
Domain Number 2 Region: 456-516
Classification Level Classification E-value
Superfamily ALDH-like 0.00000168
Family ALDH-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004886   Gene: ENSDORG00000005224   Transcript: ENSDORT00000005224
Sequence length 533
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2183:31312:51300:-1 gene:ENSDORG00000005224 transcript:ENSDORT00000005224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVLAAAGRARILQLASKANPTWYPVSSFSSSSVPTVKLFIDGKFVESRSDKWIDIHN
PATNEVIGRVPQSTKAEMDAAVAACKRSFPTWADTSILSRQQIFLRYQQLIKENLKEIAR
LITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGVCAG
IAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQ
HEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVIMPDANKENT
LNQLVGAAFGAAGQRCMALSTAILVGEAKKWLPELVERAKKLRVNAGDQPGADLGPLITP
QAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTNGATARKYSHVDVGQVGVNVPIPVPLPMF
SFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPALVMPTMGH
Download sequence
Identical sequences ENSDORP00000004886 ENSDORP00000004886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]