SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004911 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004911
Domain Number 1 Region: 198-367
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 7.56e-37
Family Extradiol dioxygenases 0.000000985
Further Details:      
 
Domain Number 2 Region: 8-135
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.76e-26
Family Extradiol dioxygenases 0.000000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004911   Gene: ENSDORG00000005248   Transcript: ENSDORT00000005249
Sequence length 392
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3322:28255:40082:-1 gene:ENSDORG00000005248 transcript:ENSDORT00000005249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYSDKGPKPERGRFLHFHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETGSREVVSH
VIKQGKIVFVFSSALNPWNKEMGEHLVKHGDGVKDIAFEDDCEHIVQKARERGAKIVREP
WVEQDKFGKVKFAVLQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPIN
EPAPGKKKSQIQEYVDYNGGAGVQHIALKTQDIISAXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKLKILVDYDENGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFGA
GNFNSLFKAFEAEQDLRGNLTDLETNGVGPIM
Download sequence
Identical sequences ENSDORP00000004911 ENSDORP00000004911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]