SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004996 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004996
Domain Number 1 Region: 140-335,379-430
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.33e-43
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004996   Gene: ENSDORG00000005340   Transcript: ENSDORT00000005340
Sequence length 440
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4566:5661:32708:-1 gene:ENSDORG00000005340 transcript:ENSDORT00000005340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKA
EWEGKGTASRSKLLDKLQTYLPPSVMLPPRRLQTLLRQAVELQRDRCLYHNTKLDSNLDS
VSLLIDHVCSRRQFPCYTQQILTEHCNEVWFCKFSNDGTKLATGSKDTTVIIWQVDSDTH
KLKTLEGHAYGVYIAWSPDDNYLVACGPDDCSELWLWNVQTGELRTKMSQSHEDSLTSVA
WNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQCLWCLSDGKTVLASDTHQRIRGYN
FEDLTDRNIVQEDHPIMSFTISKNGRLALLNVATQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXHKVYIWHRRSELPIAELTGHTRTVNCVSWNPQVPSMMASAS
DDGTVRIWGPAPFVDHQNIE
Download sequence
Identical sequences ENSDORP00000004996 ENSDORP00000004996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]