SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005206 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000005206
Domain Number - Region: 367-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family Integrin beta EGF-like domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005206   Gene: ENSDORG00000005566   Transcript: ENSDORT00000005565
Sequence length 517
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1304:21090:27840:-1 gene:ENSDORG00000005566 transcript:ENSDORT00000005565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPTSRGLRFLLVLLGLVRAAWGGVGSGASRDDDLLSPYPRARARPPRDCARVRAGYPA
HDSLAPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XYLSEEEALDTNNPFEQLLSGVVWLIRNGSIYINESQAAECDETQETGSFSKFVNVMSAR
TAIGHDRQGQLVLFHVDGQTEQRGLSLWEVAEFLLQQDVVNAINLDGGGSATFVLNGTLA
SYPSDHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
MDCGPSNCSRHGLCTDTGCRCDAGWTGPSCSEECPLGWYGPGCQRPCQCEHQCPCDPQTG
NCSTSQVKQCLQPSEATPRAAELSFFSRTTWLALTLGLVFLLLVSVSANVSLLLGSRSKR
TRHVDGDYVYHPLQEVGGESLAPEKEQPGDSHDPFKD
Download sequence
Identical sequences ENSDORP00000005206 ENSDORP00000005206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]