SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005232 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005232
Domain Number 1 Region: 8-311
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.36e-58
Family Quinoprotein alcohol dehydrogenase-like 0.041
Further Details:      
 
Domain Number 2 Region: 388-473
Classification Level Classification E-value
Superfamily RING/U-box 2.61e-24
Family U-box 0.0018
Further Details:      
 
Domain Number 3 Region: 330-400
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000003
Family SAM (sterile alpha motif) domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005232   Gene: ENSDORG00000005593   Transcript: ENSDORT00000005592
Sequence length 475
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6291:2434:32137:-1 gene:ENSDORG00000005593 transcript:ENSDORT00000005592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLVCTLADHGDDVNCCAFSFSLLATCSLDKTIRLYSLSDFTELPHSPLKFHTYAVHCC
CFSPSGHVLASCSTDGTTVLWNTQNGQTLAVLEQPGGSPVRVCCFSPDSSRLASGAADGT
VVLWNAQSYKVYRCGSVKDGSLVACVFSPNGKLLVTGSSCGDLTVWDDKMRCLHSEKAHD
LGITCCDFSSQPISDGDQDFQCFRLASCGQDCQVKIWIVSFTHLLGLKLKYKSTLSVHCA
PVLACAFSHDGQMLVSGSVDKSVMIYDTNTQNVLHTLTQHTRYVTTCAFAPSTLLLATGS
MDKTVNIWQFDLETVSQARSMEDQLKQFTEDWSEEDVSIWLCEQGLQDLVGIFKMNNIDG
KELLNLTKESLADDLKIESLGLRSKVVRKIEELKTKMNSLSSGIPDEFICPITRELMKDP
VIASGYSYEKEAIENWISKKKRTSPMTNLVLTSVVLTPNRTLKMAINRWLETHQK
Download sequence
Identical sequences ENSDORP00000005232 ENSDORP00000005232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]