SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005278 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005278
Domain Number 1 Region: 477-663
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.2e-43
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 189-289,337-373,412-474
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.84e-28
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 12-108
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.41e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005278   Gene: ENSDORG00000005642   Transcript: ENSDORT00000005641
Sequence length 673
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3540:72701:281642:-1 gene:ENSDORG00000005642 transcript:ENSDORT00000005641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTF
ENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDSCKG
WGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPP
HIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKRQNVAWLVVDSIVDVIFLVDIVLNF
HTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDEVSAFMGDPGKIG
FADQIPPPLEGRESQXXXXXXXXXXXXXXXXXXXXXXXXXXYIEYGAAVLVLVCVFGLAA
HWMCIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYI
SSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHL
NRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQD
DEVVAILGKGDVFGDVFWKESTLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSF
SRNLILTYNLRKR
Download sequence
Identical sequences ENSDORP00000005278 ENSDORP00000005278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]