SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005290 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000005290
Domain Number - Region: 498-525
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0116
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005290   Gene: ENSDORG00000005649   Transcript: ENSDORT00000005653
Sequence length 1295
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_82:26302:100669:-1 gene:ENSDORG00000005649 transcript:ENSDORT00000005653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHVELELLRDDNEQLITQYEREKALRKHAEKFEFEDSQEQEKKDLQTRVES
LESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLS
GSDQLESTAHSRIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVSHSPEPLKTVEQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XTPIGVHNNADRINSLFEKLSSTGSSLFVNVDEGADLLGMGREVENLILENTQLLETKNA
LNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNKELEEELRKARAEAEDARQK
AKDEDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIXXXXXXXXXXX
XXXXXXXXXFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKA
FDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKM
KNLPVPVYLRPLDEKDTSMKKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSK
QRSASQSSLDKLDQELKEQQKELKNQEELSSQVWICTSTHSATKVIIIDAIQPGNILDSF
TVCNSHVLCIASVPGARETDYPAGEELSESGQVDKASLCGSVTSNSSAETDSLLGGITVV
GCSTEGAVGTATSPSTNGASPVIEKPPEMEVENSEVDENVPTAEEATEATEGNAGSTEDT
VDMSQSGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDVYKDQISVLPNEQDLVREEAQKM
SSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAH
PRREQVQAWSDVWVSRLDTLRLYHAHTYQHLQDVDEYVSKMLXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXNKTSGAPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAH
AQLCFHGHRDAVKFFVAVPXXXXXXXXXXXXXXXXXXXXXXXXQESGSQTPVKSMLVISG
GEGYIDFRMGDDGESELLGEDLTGPSVFQAERSHL
Download sequence
Identical sequences ENSDORP00000005290 ENSDORP00000005290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]