SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005309 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005309
Domain Number 1 Region: 38-98
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 5.1e-31
Family Hedgehog (development protein), N-terminal signaling domain 0.0000314
Further Details:      
 
Domain Number 2 Region: 198-307
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.75e-29
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005309   Gene: ENSDORG00000005675   Transcript: ENSDORT00000005675
Sequence length 311
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4797:8:5334:-1 gene:ENSDORG00000005675 transcript:ENSDORT00000005675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPARCLLVVLVSSLLLGSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXNSVAAKSGGCFPGWATVHLERGGTKPVRELRPGDRVLAADEQGRLLYSDFLA
FLDRDDRARKVFYVIETREPRARLLLTAAHLLFVAPPHNGSAPAGRRALFASSVRPGQRV
YVASGRGGRRR
Download sequence
Identical sequences ENSDORP00000005309 ENSDORP00000005309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]