SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005368 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005368
Domain Number 1 Region: 25-497
Classification Level Classification E-value
Superfamily ALDH-like 5.37e-108
Family ALDH-like 0.00000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005368   Gene: ENSDORG00000005733   Transcript: ENSDORT00000005736
Sequence length 509
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4817:79283:109170:-1 gene:ENSDORG00000005733 transcript:ENSDORT00000005736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLIHQPQFAWLKELGLGEENEGVYNGSWGGRGEVITTYCPANNEPIARVRQXXXXXX
XXXXXXXXXXXXXXXXIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQ
EYVDVCDYAVGLSRMIGGPILPSERPGHALIEQWNPLGLVGIITAFNFPVAVYGWNNAIA
MIAGNVCLWKGAPTTSLTSVAVTKIVSKVLENNKLPGAICSLTCGGADIGTAMARDERVS
LLSFTGSTQVGKQVALMVQERFGKSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQ
RCTTARRLFLHEGIHDEVVNRLKKAYAQIRVGNPWDXXXXXXXXXXXXXVSMFGAVEAKK
AGGTVVYGGKVMNRPGNYVEPTIVTGLAHDAAIAHTETFAPILYVFKFKNEEEVFAWNNE
VKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVXXXXXXXXXXXXXXXXGEKHTGGGRESGS
DAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences ENSDORP00000005368 ENSDORP00000005368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]