SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005437 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005437
Domain Number 1 Region: 28-135
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000209
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005437   Gene: ENSDORG00000005807   Transcript: ENSDORT00000005808
Sequence length 992
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2520:148279:175454:-1 gene:ENSDORG00000005807 transcript:ENSDORT00000005808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPASLWWLWAALLVPAAAVYEDQVGKFDWRQQYVGKLKFASLEFSPGSKKLVVATEK
NVIAALNSRTGEILWRHVDKGTAEGSVDAMLLHGQDAITVSSGGRIMRSWETNIGGLNWE
ITLDSGSFQALGLVGLQEAVRYVAVLKKTTLALHHLSSGHLKWVEHLPEXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRVSTPWLQHLTGACGVVDEAVLVCPDL
SSRSLQTLALETEWELRQISLQSLNLEFGNGFQPRVLSTQPNPVEPSRAQFFLQVSPSHY
ALLHYHHGALSLLKNFPQTALVSFATTGEKTVAAVMTCRNEAKPSNSEDGSRAGFSEKSS
AQDSLMCFNQTYTINLYLVETGRRLLDTAISFGLEQNGTRPEKLYIQVFLKKDDSVGYRA
LVQTQDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLL
GMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTA
SGKLFGIESSSGTILWKQYLPSVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKETGMSSL
YVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQ
LHELAPSIFFYLVDSEQGRLSGYRLRKDLTTELSWELTIPPEIQRIVKVKGKRSSEHVHS
QGRVMGDRSVLYKSLNPNLLAVVTESTDIHHERTFIGIFLIDGVTGRIIHSSVQRKAKGP
VHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFP
SSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPD
VQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYD
YVLISSVLFGLVFATMITKRLAQVKLLNRAWR
Download sequence
Identical sequences ENSDORP00000005437 ENSDORP00000005437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]