SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005446 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005446
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-26
Family Kringle modules 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005446   Gene: ENSDORG00000005816   Transcript: ENSDORT00000005817
Sequence length 357
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2723:146:3824:1 gene:ENSDORG00000005816 transcript:ENSDORT00000005817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSECFQVNGADYRGHQNHTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNP
DGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVPVC
LLFCRMNGYQLAVVYAGYSCFCVSEGYFVSGRSAPLLRCHICFESPVLLCLCDLLVFFXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXRPPPAGPERLRTDAMIISFRDARGHAQGFEMTYRGLQDASEDDAAA
PEGSAHTPAEPLDGANASCSPRPGAPQPAVGARVSSTVMAISVKMKKILSMMRLLRR
Download sequence
Identical sequences ENSDORP00000005446 ENSDORP00000005446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]