SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005467 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005467
Domain Number 1 Region: 394-634
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-35
Family Kelch motif 0.01
Further Details:      
 
Domain Number 2 Region: 747-913
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-23
Family C-type lectin domain 0.0039
Further Details:      
 
Domain Number 3 Region: 121-243
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1053-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000121
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005467
Domain Number - Region: 92-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 328-356
Classification Level Classification E-value
Superfamily Kelch motif 0.00562
Family Kelch motif 0.015
Further Details:      
 
Domain Number - Region: 241-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00904
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005467   Gene: ENSDORG00000005836   Transcript: ENSDORT00000005839
Sequence length 1418
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_861:13099:102188:1 gene:ENSDORG00000005836 transcript:ENSDORT00000005839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAAAATEARLRGKTAVTAAPADRKGGRPLDGNVTGAERPGLGAGLRLPRLLSPSLPRL
LLLSPLLLLLSWEAEAAAAAAVVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPAGWVGE
QCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLY
VYDGDSIYAPLIAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYNF
DMCPNNCSGRGECKISNSSNTVECECSENWKGESCDIPHCTNNCGFPHQGICNSSNVRGC
SCFSEWQGPGCSIPVPANQSFWTREEYSHLKLPRASHKAVVNGNIMWIVGGYMFNHSDCN
MVLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKIYMYGGKIDSTGNVTNELRVFHIH
NESWVLLTPKAKEQYAVVGHSAHIVTLQSGRVVMLVIFGHCPLYGYISSVQEYDLDKNTW
NILQTSALVQGGYGHSSVYDPTKALYVHGGYAFSANKYRLADDLYRYDVDTRMWTILKDS
RFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIXXXXXXXXXXXXXXX
XXXRFGHTAVLHNSTMYVFGGFNSLLLSDILIFTSEQCEAHQSEAACIAAGPGVRCVWDT
GSAQCISWEFTTEEQAQKLKSECFSKRTFEHDRCDQHTDCYSCTANTNDCHWCNDHCVPM
NHSCTEGQISISRYEKCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGI
GWHLVENSCLKITTAKENYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRIMQSSQSMSK
LTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTRGLKAATCI
NPLNGSVCERPANHSAKQCRTPCALRTACGECTSSSSECMWCSNMKQCVDSNAYVASFPF
GQCMEWYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKIPSQ
SSSGNAYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCE
TCISGFYGDPTNGGKCQPCCNGHAXXXXXXXXXXXXXXXXXXXXXXXXCEVENRYQGNPL
KGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNLNITWAA
SFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIKIQXXXX
XXXXXXXXXXXXXXXXXCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASV
NVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLA
VASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPDTCI
Download sequence
Identical sequences ENSDORP00000005467 ENSDORP00000005467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]