SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005471 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005471
Domain Number 1 Region: 5-194
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 8.63e-59
Family D-ribulose-5-phosphate 3-epimerase 0.00000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005471   Gene: ENSDORG00000005846   Transcript: ENSDORT00000005845
Sequence length 194
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2074:415044:430802:1 gene:ENSDORG00000005846 transcript:ENSDORT00000005845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAIAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMI
Download sequence
Identical sequences ENSDORP00000005471 ENSDORP00000015843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]