SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005501 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005501
Domain Number 1 Region: 974-1193
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.39e-42
Family YicI N-terminal domain-like 0.009
Further Details:      
 
Domain Number 2 Region: 85-262
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.2e-27
Family YicI N-terminal domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 1461-1555
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.86e-21
Family YicI catalytic domain-like 0.0051
Further Details:      
 
Domain Number 4 Region: 626-707
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.32e-21
Family YicI catalytic domain-like 0.016
Further Details:      
 
Domain Number 5 Region: 1558-1638
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.35e-18
Family Putative glucosidase YicI, domain 3 0.024
Further Details:      
 
Domain Number 6 Region: 710-790
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000115
Family Putative glucosidase YicI, domain 3 0.028
Further Details:      
 
Domain Number 7 Region: 925-985
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000112
Family Trefoil 0.0034
Further Details:      
 
Domain Number 8 Region: 1197-1277
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000337
Family YicI catalytic domain-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005501
Domain Number - Region: 380-447
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00885
Family Amylase, catalytic domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005501   Gene: ENSDORG00000005876   Transcript: ENSDORT00000005876
Sequence length 1778
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_905:15202:110584:-1 gene:ENSDORG00000005876 transcript:ENSDORT00000005876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKFSGLEISLIVLFLIVTIIAVALVIVLATKTPAVEVLDKPTSTPATTASPSGLGKC
PAELNDLTNTRINCIPEQFPTQTVCAQRGCCWRPGNNTGVPWCFFADNHGYRIQQKTAKN
TGLEAILNKISSPTLFGNDIHTVLLTTQSQTANRLRIKITDPNNNRYEVPHQYVKDFSGT
APSETLYEVQTTDNPFSIKVIRKTNNKVLFDTSVGPLIYSDQYLQISTKLPSEYMYGLGE
HIHQRFRHDVNWRTWPIFTRDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXDTQVTDIDYMEDKKDFTYDEVTFKGLPEFAEDLHAHGQKYV
IILDPAISINKRANGASYESYDRGNAKHVWVNESDGVTPLIGEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILDRLMYSKT
LCMDAVQNWGTQYNVHSLYGYSMSIATEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVGADICGFIANTTEELCRRWMQLGAFYPFSRNHN
ADGYAEQDPAVFGKDSLLVRTSRHYLRIRYTLLPFLYTLFYRAHMFGETVARPVLHEFYN
DMNSWVEDLEFLWGPALLITPVLKQGAEVVSAYIPDATWYDYETGAKRPWRKQRVNMYLP
EDKIGLHLRGGYIIPIQQPDVTTTASRKNPLGLIVALDENNTAKGDFFWDDGESIKSIDD
GIYILYEFSVSNKNLQITCKHANYEEGTTLAFETIKVLGLTETVTEVTVAENNQAMSAHA
NFTYDASNQVLLITDLKFNLGKNFTIQWNQVFPDYERFNCYPDSDTIDEEECLKRGCVIA
KGIPKAPECYFPRQDNPYSVSSVQYLPTGMTADLQLNPTNARIQLPSTPIVALRVEVKYH
KNDMLQFKIYDSQNKRYEVPVPLNIPETPMSTHENRLYDVEIRENPFGIRVRRRSTGRII
WDLLPGLFIDIQISTRLPSEYIYGFGEVEHQAFRHDLQWHTWGMFTRDQPPGYKLNSYGF
QPYYMALEEEGNAHGVLLLNSNGMDVTFQPTPALTYRIIGGILDFYMFLGPTPEVATKQY
HEVIGHPVMPPYWALGFQLCRYGYRNTSEIQQLYDDMVAAKIPYSIHLLDPAISGNETKP
YPAFSRGITNDVFVKWPDTSEICWAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDMNEPSSFVNGTTTNQCRNDRLNYPPYSPALTRN
EGLHSTMCMETEQILSDGSSVLHYDVHNLYGWSQMKPTYXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXMMEFSLFGISYTGADICGFFNNSEYHLCARWTQLG
AFYPYSRNHNIAFTRRQDPVSWNTSFAEMSKNVLEIRYTLLPYFYTQMHEVHAKGGTVIR
PLLHEFFQEKTTWDIFKQFLWGPAFMVTPVLEPYVTSVHGYVPDARWFDYHTGEEINIRG
GYHTFSAPFDMINLHVRGGYILPCQEPARNTFHSRKNYMKLIVAADDNQMAGGSLFWDDG
DTINTYERDMYLLVEFNLNKTTLTTTILKNGYRNRDETRLGNIAVWGEGSTAIHEVSLRR
NDNIEALPFSHNTTTKILDINLRNHNVTLDEPIQISWS
Download sequence
Identical sequences ENSDORP00000005501 ENSDORP00000005501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]