SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005661 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005661
Domain Number 1 Region: 72-422
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000000563
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005661   Gene: ENSDORG00000006047   Transcript: ENSDORT00000006048
Sequence length 548
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_19022:5424:15694:-1 gene:ENSDORG00000006047 transcript:ENSDORT00000006048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDNKDLEAENHPLKNEGRKSQENLKNQLKNEDHLKSKPLQSRLSRCRAVAFFLSLFICL
SVVFVVSFLIPCPASLQMWRIDYNAAVIYDFLTMEDINRDRIQDVLFLYKNTNSSNNFTR
SCAGEGFSTPCAFVAAVSGANGEIIWERPVAQDVALVECAVLQPSNNEASSTCIFVGRPG
SLIAVDLFTGNTLWSHPSNLSENTSVLSPLLQVPDVDGDAVPDLLLLTQEGKKVSGDIYS
LNTGHQIGHRGALDVNGDHGALLHITWTGAHYILLPCVSFLCGCSVKGLYEKVTGRDGPF
TNDPLWENMLNTSEHRRLLHSSGEVRHLMNVRGNTGQDVLLVTSEACVLLDGQELTPRWT
VSGARILRKPILGHYKPDTLAVVIENGTGIDRQMLFLDLSTGAVLWSQALPSFPGAPPSV
SLLTTDHRSAFFFWGLHELIGTSVMEPRDAQHSLYMFHPTLPSLLELANVSANVVAFDVV
LFEPNRHAAYVLLTGPASSHEPGLVSVAKHKVQDLVPGSRVVRLGEGGSESDRAIKDRFS
RLRYLSAA
Download sequence
Identical sequences ENSDORP00000005661 ENSDORP00000005661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]