SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005682 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005682
Domain Number 1 Region: 430-760
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-106
Family PDEase 0.00000127
Further Details:      
 
Domain Number 2 Region: 162-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.99e-18
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005682
Domain Number - Region: 36-107
Classification Level Classification E-value
Superfamily CheY-like 0.00249
Family CheY-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005682   Gene: ENSDORG00000006070   Transcript: ENSDORT00000006070
Sequence length 772
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6823:76451:244554:1 gene:ENSDORG00000006070 transcript:ENSDORT00000006070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSSAEVRIGPMRLTQDPIQVLLVFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFL
DKHHEIIVIDHRKTRYFDAEAVCRSIRATNPSEHTVILAVVSHISDDCEEASVLPLLHAG
FNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQY
VNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGD
SIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAE
ALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSH
LAMPVTINDVPPSIAQLLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCT
ETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAAT
VHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHY
RTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPTGKNFPENQILIK
RMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQ
ISFIDYFITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDP
Download sequence
Identical sequences ENSDORP00000005682 ENSDORP00000005682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]