SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005718 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005718
Domain Number 1 Region: 21-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00052
Further Details:      
 
Domain Number 2 Region: 135-321
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.61e-38
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 345-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-34
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 949-1161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-34
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 5 Region: 770-945
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.8e-31
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 6 Region: 562-620
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000733
Family Fibrinogen C-terminal domain-like 0.003
Further Details:      
 
Domain Number 7 Region: 533-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000381
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005718   Gene: ENSDORG00000006105   Transcript: ENSDORT00000006107
Sequence length 1307
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5504:33254:828827:1 gene:ENSDORG00000006105 transcript:ENSDORT00000006107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRAWTAPSTSQKCDDPLVSGLPHSAFSSSSSMSASYAPGYAKINKRGGAGGWSPSDSDHY
QWLQVDFGHRKQLSAIATQGRYSSSDWVTQYRVLYSDTGRNWKPYHQDGNIWAFPGNVNS
DSVVRHELQHAVIARYVRMVPLDWSGEGRIGLRIEVYGCAYWADVINFDGHVVLPYRFRN
KKMKTLKDVISLKFKTSEGEGVILHGEGQQGDYITLELKKAKLVLSLNLGSNQLGPIYGH
TSVMAGSLLDDNHWHCVVVERQGRSINLTLDRSLQHFRTNGEFDYLDLDYEITFGGVPFS
GKPSSSSRKNFKGCMESINYNGINITDLARRKKLEPSNVGNLSFSCVEPYTVPVFFNATS
YLEVPGRPHQDLFSVSFQFRTWNPNGLLLFSHFADNLGNVEIDLTESKVGVRVNVTHIRM
SQIDISSGSALNDGQWHEVRFLAKENFAVLTIDGDEASAVRTNSPLQVKTGEKYFFGGFL
NQMSNSSHSTLQPSFQGCMQLIQVDDQLVNLYEVAQRKPGNFANVSIDMCAIIDRCVPNH
CEHGGKCSQTWEGFKCTCDETGYSGATCHNSIYEPSCEAYKHLGQTSNYYWIDPDGSGPL
GPLKVYCNMTEDKVWTIVSHDLQMQTTVVGYNPEKYSVTQLLYSASMDQIGAITSSAEYC
EQYVSYFCKMSRLLNTPDGSPYTWWVGKANEKHYYWGGSEPGIQKCACGIERNCTDPKYY
CNCDADYKQXXXXXXXXXXXXXXXXXXXXXXXXXXXGSEAKLSVGPLRCQGDRNYWNAAS
FPNPSSYLHFSTFQGETSADISFYFKTLIPRGVFLENLGNTDFIKLELKSATEVAFSFDV
GNGPVEIVVRSPSPLNDDQWHRVTAERNVKQASLVDRLPQQIRKAPTEGHTRLELYSQLF
VGGAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFKSRSGHCTSYGANCENGGKCIEKY
HGYSCDCSHTPYDGTFCNKDVGAFFEEGMWLRYNFQPPTVSARDAGSRAEHTVDPQPPAP
DLAGEHILFSFSTTKAPCILLYVSSLSTDFLAVLVKPTGSLQIRYNLGGTREPYNADVDH
RNMANGQPHSVNITRQERTITLKLDHYPSVSYHLPSSSDLLFNSPKSLFLGKVIETGKID
QEIHKYNTPGFTGCLSRVQFNHIAPLKAALRHTNASAHVHVQGELVESNCGASPLTLSPM
SSATDPWHLDHLDSXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIAVVIFTILCTLVFLIR
YMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI
Download sequence
Identical sequences ENSDORP00000005718 ENSDORP00000005718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]