SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005873 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000005873
Domain Number - Region: 549-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005873   Gene: ENSDORG00000006271   Transcript: ENSDORT00000006273
Sequence length 687
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6490:148259:168273:1 gene:ENSDORG00000006271 transcript:ENSDORT00000006273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITSGRGRRRRGAWLSPVQRSPESTRPELLPRSRPPARGPRGHRRPSPGGGERSRESPRLR
SGLQLPSVLLLLLLFSVLGPGAGGLFLTDYSTCSPRKLSPFRSFASTELFHFHVPEDTFL
AVWNLIIFKEQGGTFGDHCPDQSVTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLQDECQYLLQPQLIIRRLLDVAVL
VPGRPSEQTLSFHNHSALYKVFVPSFTYRVSAQLVCVGSRAVSTCPLTLRLRPKAPPLHN
SSSVACGGASVCQLELALPPWGHWVYVRVETPSRGPSRTVRFQLVVRLQECPQPSLSRAL
VPGAAMNMPQSLGNQQLPPELPSLGTPVEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYI
FFGPSVALPPERPAVFALRLLPVLDSGGVLSLELQLNVSSLHQENVTVFGCLTHEVPLSL
GDAAVTCSKESLAGFLLSVSATSRVARLRIPFPQTGTWFLTLRSLCGVGPRFVRCRNATA
EVRLRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLS
TLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCSGVPVSPCPCPWWRAGVCIS
TTFSMGVGTSLSSPCLRTVLLFCKVPD
Download sequence
Identical sequences ENSDORP00000005873 ENSDORP00000005873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]