SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006233 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006233
Domain Number 1 Region: 1105-1222
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-29
Family C-type lectin domain 0.00065
Further Details:      
 
Domain Number 2 Region: 212-349
Classification Level Classification E-value
Superfamily C-type lectin-like 9.11e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 947-1091
Classification Level Classification E-value
Superfamily C-type lectin-like 3.61e-27
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1372-1493
Classification Level Classification E-value
Superfamily C-type lectin-like 4.03e-21
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 5 Region: 34-143
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.11e-20
Family Cysteine rich domain 0.014
Further Details:      
 
Domain Number 6 Region: 500-625
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-19
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 7 Region: 636-754
Classification Level Classification E-value
Superfamily C-type lectin-like 3.47e-17
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 8 Region: 798-930
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000287
Family C-type lectin domain 0.021
Further Details:      
 
Domain Number 9 Region: 421-494
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000612
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 10 Region: 159-213
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000771
Family Fibronectin type II module 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006233
Domain Number - Region: 1564-1602
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000507
Family C-type lectin domain 0.013
Further Details:      
 
Domain Number - Region: 1318-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00133
Family C-type lectin domain 0.011
Further Details:      
 
Domain Number - Region: 1230-1277
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0307
Family C-type lectin domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006233   Gene: ENSDORG00000006646   Transcript: ENSDORT00000006651
Sequence length 1718
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3069:64917:147991:-1 gene:ENSDORG00000006646 transcript:ENSDORT00000006651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRWATPRGAARFVLLPLLCCLGLAEPSGRSGHDPFTIVNENTGKCIKPLYDWIVATNC
DGSSDTLWKWVSQHRLFHLESQKCLGLDLSKSKDSLGMFSCDSTTMLWWKCDHQSLYSAA
QYRLALQGGYAVASTNTSDAWRKGVXXXXXXXXXXXXXIYTRGGNSYGRPCEFPFLMDGI
WYHDCVLDEDHSGPWCATTFNYAYDQKWGICLKPENGCEGNWEKNEQIVSCYQFNTQTAL
SCKEAYVSCQNQGADLLSINSAAELXXXXXKEDIARIVWLGLNQLYSTRGWEWSDHRPLN
FLNWNLDMPSKSVIGGSSCAGMDAESGLWKSISCEAQLPYVCKKPLNATVELTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVK
EEIWTGLKNINMPTLFQWSDDSEVTLTYWNENEPQVPFNKTPNCVSYLGKLGQWKVQSCE
EKLKYVCKKKGEKMNDTRSDMCPAEGWKRHGESCYKIYMDEVPFGTNCNLTITSRFEQEY
LNDMMKKYAKSLSKYFWTGLRDVDSRGEYSWATVGGIKQAITFSNWNFLEPASPGGCVAM
STGKSLGKWEVKDCRNFRALSICKKISAPLEPEEPAPKPDDPCPEWQSFPTSLSCYKVFH
VERIVRKRSWEEAERFCQALGAHLPSFSHTNEIKEFLHLLREQFSDQRWLWVGNKRSPDL
QGSWEWSDHTPVSTVTIENEFQQDYDIRDCAAVKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSTSKTPEWYNPERAGIHGPPTIIEGSEYWFVADPHLNYEEAVLYCAS
NYSFLATITSFTGLKAIKNKIANISGAEQKWWVKTNEQPIDRYFMYAQHPWHRFPVTLGE
ECLHMSAKTWFMDLNKPADCSTKLPFVCEKYNVSSLEKYSPDSAAKVQCSGSWIPFQNKC
FLKISAKSLTFSQASTLCHSYGGTLPSVLSQSEQDFITSLLPEMEANLWIGLRWTAYERI
NKWTDNRALTYSNFHPLLVGRRLNIPTNFFEEESLYHCALLLNLHKSPFTGTWNFTSCAE
SHFVSLCQKYSDFEDRQLLQNVSETVKYQNNLYKIIPKTFSWHEALQECERERMHLVSIT
DPYQQAFLSVQAARRNYSLWIGLSSQDDELSFSWSDGKHLHFSRWAENNQQLEDCVILDT
DGFWKTADCNDNQSGAICYYPGNETEKEVKPVKSVKCPSPVLNTPWIAFQNSCYIFMITK
NRHTVATQDEVHSKCQELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSS
LMWLDKTSLSYAHWRAGRPTVKNGKFLAGLSTDGFWDIQPFNVIEETLYFHQHSIISCKI
EMVDYKEEYNTTLPQLIPYKDGIYNVIQKKVTWYEALNLCSQSGGHLASVHDLQDQLFLE
DIVKRDGFPLWVGLSSHDRELSFEWSDGSALDYIPWKNQTSPEIVVFLHKGLWQHEXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXHSATIVTIEDENENKFVSRLMRENNNITMRVWLGLLQHSGXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDYRGMVITFVVLSILAFIT
GLIWFLCQKNRFHLASFSSVRYEQGINEDEIMLPSLYE
Download sequence
Identical sequences ENSDORP00000006233 ENSDORP00000006233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]