SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006428 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000006428
Domain Number - Region: 11-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0275
Family Integrin beta EGF-like domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006428   Gene: ENSDORG00000006861   Transcript: ENSDORT00000006861
Sequence length 758
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3633:8616:35601:1 gene:ENSDORG00000006861 transcript:ENSDORT00000006861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFSPPTSTTTQFCRNGGTWENGRCICTEEWRGLRCTIVNFCENSTYQELNFARIPVGRYG
PSVQTCGYNTLNAGKPLAIRLCTFSPYGEIILQNVTRGNCNENLESLEKQIDNIATKSQN
ISIEVQILTSNTTELTAENITSASNVVGQIFNESRKATSETKRLAVSTVSQLLDVREDIF
QVATADANNAFTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXHNPDGQTELQILLKTRKNNSISKKFGFVVYQNNKLFQSKTF
MTKSNFSQKIISGKIGENEKDASVEMVFNPTYNKKVFQLYSYACVYWNLSTNNWDTYGCK
KGNVTDGFLGCQCNHTTNFAVLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XKVRKTSVTWVMVSLCVSMLIFNLLFVFGIENTQNKNLNTNDTNTNIPSTNIIPETDTAD
IPNPSCTVFAALLHYFLLVTFTWNGLNAVQLYFFLIRTMKPLPSHFILFISLVGWGVPAI
VVGVTVGIIYAQHTKDPNWELEYRQEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXTQKVSFLKKILSTLSIAVLFGLTWILSYLMLINNDDIRII
FSYIFCLANTTQGLQIFILYTVRTKVFQNEASKALKSLSSSFGRMKPLPSMTPLRLRVRM
YNMLRSLPNLYEHFRLLESSLTTEETTLTKSDQTNSSV
Download sequence
Identical sequences ENSDORP00000006428 ENSDORP00000006428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]