SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006540 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006540
Domain Number 1 Region: 27-159
Classification Level Classification E-value
Superfamily Cupredoxins 2.13e-45
Family Ephrin ectodomain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006540   Gene: ENSDORG00000006976   Transcript: ENSDORT00000006976
Sequence length 204
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4610:57271:61096:1 gene:ENSDORG00000006976 transcript:ENSDORT00000006976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPLLRTVLWAALLGSPLRGGSGLRHPIYWNSSNPRLLRGDAVVELGLNDYLDIFCPH
YESPGPPEGPETFTLYIVDWSGYQACQAEGANVFLRWKCSMPFAPMGPVRFSEKIQRFTP
FSLGFEFLPGETYYYISVPTPESPGQCLRLQVSVCCKESKSESAHPVGSPGESGTSGWRG
GHTPSPLCLLLLLLLPILRLLKVL
Download sequence
Identical sequences A0A1S3F2Z7
XP_012870600.1.60039 ENSDORP00000006540 ENSDORP00000006540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]