SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006609 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006609
Domain Number 1 Region: 3018-3150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.42e-52
Family Single strand DNA-binding domain, SSB 0.00000801
Further Details:      
 
Domain Number 2 Region: 2638-2766
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.97e-42
Family Single strand DNA-binding domain, SSB 0.00000133
Further Details:      
 
Domain Number 3 Region: 2768-2797,2934-3017
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.68e-34
Family Single strand DNA-binding domain, SSB 0.0000365
Further Details:      
 
Domain Number 4 Region: 2797-2933
Classification Level Classification E-value
Superfamily BRCA2 tower domain 3.27e-33
Family BRCA2 tower domain 0.0000166
Further Details:      
 
Domain Number 5 Region: 2571-2637
Classification Level Classification E-value
Superfamily BRCA2 helical domain 7.19e-32
Family BRCA2 helical domain 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006609   Gene: ENSDORG00000007049   Transcript: ENSDORT00000007050
Sequence length 3367
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1038:358641:411759:1 gene:ENSDORG00000007049 transcript:ENSDORT00000007050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIESPGRPTFFEIFKTQCSKADLGPISLNWFEELSSEAPPYNSEYADESEYKINSYEPN
SFKTPQRKPFYQLASTPIAFKEQGQTLRVQPSPLKELGKYLDLGKDIANNEHKNCHTKVE
HIIDVTSPSLNSCLTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKKPKHISESLGV
EVDPDMSWSSSLATPPTLSSTVLIVRDEETSGTIFPNDPTVILKNYFSKHKESLKKNYHF
IPSVTNSENKNQREASSHGFGKVLENSFGKVNSDKDDFRTSMTDTQEDEVHETVADFSEE
DSFSLCFSKKRTGNLHKTRLDKTRKKIFCETSTDEFSEKDKQVKEDKYSFASEVEPSDDD
PLDTNLGNQNPFGHESNKASKEAVPSSDWEWSQLNLSGLNETQMEKMPLLPISSYDQGNS
ENNLIDTEKECMTSINTKNSLLPISSLPQSEEILQEETLIDKRDEEQQLESHEDSFLVAK
QIVPGTSPTVSPFPSIKKSLFRIRQPSEETSDEVFSGNLTKTNFKEESGTFESGMEIRAI
CSQKADSLFPSSLDSEKHPATSTHTSVTLKIEGLISSLKKKKKKFIYAIDDETSCQVKKS
QKLQKSEPTNHSSQCEAPLIFTDAYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSPVLGTTEELY
EADHSCVKEPIFKNCMMVIDTDIDDKQAAHVLITEGLIYDLTEENKNSAKQNLKRTLSQE
LKSNSFLDIKDIKSNRNNYYEDKLSGLLNPLTDHSFRGGFRTASNKEIKLSEHNIKKSKV
LFKDIEEKYPTSLPCVEIANTNTLTLDHQKKLNKLNISNSKLVNTVSPSVQSGTFIPDCE
NNHTSPLKQDISANHNLTPSQRAEVTELSTILEESGSQFEFTQFRKLCHRAQNLTSEVPK
NQMADSNHTSDLHLGQVDRSEKLKEVARIKQTSACLLKNYNKSTGESEKEFQGFYSALGT
KLSISTEALQKALKLFSDIDIIHEETSVEAEPRFSSSNSHDSFVSAHKIESHTNNKNLHE
KNSKCQLILQNNIEMTPGIICEENTENYMRNTGSKCNRCTDMSRSICKLQESDGTDSSRN
DDKVYIHKDESNLQCTDRHNIYIKSASQFTKEGNIQTKECLSDLTCLEVMKAEETCLTNS
SNKEQLTVGKKEQNVKDFDITSPTASGKNNRVPEESSNFFDKHMGEISNFSNSFNSELLS
GIIKSKVDISCHGETDMTENKISEEGIPVGNRKQPXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTTKERQEMQNPNVTAPDKGFLSKPHLDKHLEK
SSSNLPDSGQLVHKIPNTRNETMRQSVTIGKLAKVFVPPFKVKSHLHKDEHHVSKQTNFE
EEKQKQRKIEECGSSDCENINSEIHQFSKDSSCQEATMIFTKCKEPLXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALCDTPGVD
PKLISRAWAYNHYRWLIWKLAAMEFSFPKEFANRCLNPERVLLQLKYRYDMEIDRSKRSA
IKKIMERDDTPAKTLVLCVSDIISSTSETCSNKTDGADTKNVAMLELTDGWYAVKAQLDP
PLLALLKNGRLAVGQKIITHGAELIGSPDACAPLEAPDSLMLKISANSTRPACWYTKLGF
FPDPRPFPLPLSSLFSDGGNVGCADVIVQRVYPIQWMEKTPSGLYIFRNEKEEEREAAKF
AEAQQKKLEALFTKIQTEFEKHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXSYFSEEQLRALNNHKQMLNDKKQAQIQLEFQKAMESAEKVEERLSRDVTPVWKLCI
VSYGKKGRDAVTLSIWRPSSAVLSLLTEGNRYRIYHLATSKSKCKSERANIQLTATKRTQ
YQQLPASDEILFQVYQPREPLQFSRLLDPDFQSPCSEVDLIGFVVSVVKKIGLAPLVYLS
DEYHNLLAIKFWIDLNEDVIKPHTLIAASNLQWRPESKSGIPTLFAGDHSMFSASPRENH
FQERFHKMKNTVENIDVLCNDAKKKLMSLLNANYPKWSNPTKDYKSEPCPAYSALGVDNE
VLSSPSSKQNYQSHLSLCTPKEKCLPNPVSAQMISESSHKEEKEIDDPTCKKRKALEFLT
RLPLPPPVSPICTFVPAAQKAFQPPRSCGTKHRTTKRKELNFPPVTPFKKVNEISLLERD
SIADEELALLNTQSLVSDSMGESHLLIRESKRTTPSSTQDHLGQKKQQESLMGGQGNPQA
GTKECEK
Download sequence
Identical sequences ENSDORP00000006609 ENSDORP00000006609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]