SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006697 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006697
Domain Number 1 Region: 14-225
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.7e-70
Family Carbonic anhydrase 0.0000000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006697   Gene: ENSDORG00000007143   Transcript: ENSDORT00000007142
Sequence length 225
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_29849:10589:12998:-1 gene:ENSDORG00000007143 transcript:ENSDORT00000007142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHWCYEIQAKEVNSNCLGPDKWSGDCHKSRQSPINIVSSKAKVNHSLGHFSFFGYDKKQR
RTVQNNGHSVMVLLGKEARLSGGGLAAQYQATQFHLHWSQELDRGSEHTLDGERFAMEMH
IVHEKETEASNHAQSSEDEMAVLAFLVQEGDKMNEGFEPLLEALQSIPEPDMNTTMRESS
LMDLLPNREKLKDYFRYLGSLTTPSCDETVIWTVFKEPIQLHREQ
Download sequence
Identical sequences ENSDORP00000006697 ENSDORP00000006697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]