SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006702 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006702
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.88e-57
Family Ran-binding protein mog1p 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006702   Gene: ENSDORG00000007147   Transcript: ENSDORT00000007147
Sequence length 186
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5721:30648:31798:1 gene:ENSDORG00000007147 transcript:ENSDORT00000007147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDFPLFGGAFSVILPPGAIDVSDLRPVPDNQEVFCHPETDQSLIVELLELQAHVQG
EAAARYHFEDVGWVQEARIQQVESVQPLTLENLALRGCCQEAWLLSGKQQITKGSQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPPSENRSSLGPENLSPPPWSLSNFEQLVTSLTLHDP
NIFGPQ
Download sequence
Identical sequences A0A1S3EWQ0
ENSDORP00000006702 XP_012868841.1.60039 ENSDORP00000006702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]