SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006706 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006706
Domain Number 1 Region: 87-308
Classification Level Classification E-value
Superfamily DNA-glycosylase 8.64e-68
Family Mismatch glycosylase 0.0000466
Further Details:      
 
Domain Number 2 Region: 350-491
Classification Level Classification E-value
Superfamily Nudix 2.35e-26
Family MutY C-terminal domain-like 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006706   Gene: ENSDORG00000007152   Transcript: ENSDORT00000007152
Sequence length 543
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6140:4439:12734:-1 gene:ENSDORG00000007152 transcript:ENSDORT00000007152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARVPHWILWDIMKKPRAAVRSHRKQAACLEGRENHALNSTQAKPSAPDVVIPEYPGAS
TGLIKQNEVLRASVCPYHLFRDTAEVTVFDSLLSWYDREKRDLPCRWAEDEADLDRRAYA
VWVSEVMLQQTQVATVINYYTRWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEG
ARKVVEELGGHVPRTAETLQKLLPGVGRYTAGAIASIAFGQATGVVDGNVIRVLCRVRAI
GADSSSTFVSQQLWSLVQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPIQDLCWAR
QKVEQEQLSVSRSLPGSPDVEECAPNPGQCQLCPPPSEPWDPTMGVTNFPRKATRKPPRE
ECSAICVLEQPRAQGGGCFLLVQRPNSGLLAGLWEFPSITLKPSEQHQRKAKALLQELKS
WVGPLPATSLRHLGEVIHTFSHIKLTYLVYGVTLEGQTPKTLPPGARWLTREEFHTAAVS
TAMKKVFQMYEDQPGSCKXXXXXXXXXXXQKMPSRKPSRGQQVLEKFQPHVPTDSQSLNS
AAL
Download sequence
Identical sequences ENSDORP00000006706 ENSDORP00000006706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]