SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006711 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006711
Domain Number 1 Region: 110-362
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.51e-80
Family Glutamine synthetase catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 17-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.83e-20
Family Glutamine synthetase, N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006711   Gene: ENSDORG00000007158   Transcript: ENSDORT00000007157
Sequence length 373
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_27381:7497:15385:-1 gene:ENSDORG00000007158 transcript:ENSDORT00000007157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSASSHLNKGIKQSYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDCEPKCVEELPEW
NFDGSSTYQSEGSNSDMYLLPAAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHTCKRI
MDMVGSQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
RACLYAGIKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLRFIEEAIDRLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRSASIRIPRTVGQEKRGYFEDRRPSANCDPYAVTEAIVRTCL
LNETGDEPFQYKN
Download sequence
Identical sequences A0A1S3F5N0
ENSDORP00000006711 ENSDORP00000006711 XP_012871142.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]