SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006887 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006887
Domain Number 1 Region: 15-495
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-161
Family ALDH-like 0.000000000000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006887   Gene: ENSDORG00000007344   Transcript: ENSDORT00000007343
Sequence length 500
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4834:20954:63154:-1 gene:ENSDORG00000007344 transcript:ENSDORT00000007343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAKPDIPAPLDNVKYEYTKIFINNEWHDSVSGKKFPVLNPATEEEICQVAEGDKADVD
KAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESINGGKIFSNAYLM
DLGGCIKTLRYCAGWADKIHGSTIPSDGNLFTYTRHEPIGVCGQIIPWNFPLVMFIWKIG
PALSCGNTVVIKPAEQTPLTALHMAALIKEAGFPPGVVNVVPGYGPTAGAAISSHMDIDK
VAFTGSTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNAVQMAHQGVFYHQGQ
CCVAASRLFVEESIYDEFVRRCVERAKKYVLGNPLTPGISQGPQVDKEQHNKILDLIESG
KKEGAKLECGGGRWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKTVDEVIKRA
NNTTYGLAAGIFTKDLDKALTVSSALQAGVVWVNCYLLLSAQCPFGGFKMSGNGREMGEY
GLREYTEIKTVAMQISEKNS
Download sequence
Identical sequences ENSDORP00000006887 ENSDORP00000006887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]