SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007010 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007010
Domain Number 1 Region: 150-268
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.2e-38
Family Astacin 0.00017
Further Details:      
 
Domain Number 2 Region: 769-880
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 463-567
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 614-724
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 725-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000147
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 570-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 382-417
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000707
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007010
Domain Number - Region: 965-997
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00012
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007010   Gene: ENSDORG00000007473   Transcript: ENSDORT00000007473
Sequence length 1009
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_231:13425:162998:1 gene:ENSDORG00000007473 transcript:ENSDORT00000007473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLEARRPAMLAWLLVTAGVVLCAGLGGDYAWDGDEEEDRTETLDYKDPCKAAVFWGDIA
LDDEDLNIFQIDRTIDLTQNPFGRAGHTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVWPGGVIPYVIGGNFTGSQRAMFKQAMRH
WEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGH
VIGFWHEHTRPDRDNHVTIIRENIQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICGGEIRKNEGQIQSPNYPDDYRP
MKECVWKIAVSEGYHVGLNFQAFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPED
IRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPG
YELGADRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPIQYRISVKFEFFE
LEGNEVCKYDFVEIWSGLASESKLHGKFCGAEVPDVITSQFNNMRIEFKSDNTVSKKGFK
AHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHENKHDCKEAECEQKIHSPSGL
ITSPNWPDKYPSRKECTWEISTIPGHRIKLVFSEFEVEQHQECAYDHLEVFDGQTEKSPI
LGRLCGNKIPDPVVATGNQMFVRFISDASVQRKGFQATHSTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPPEEIYSVGDAVLIHFHTDDTINKKGFYIRYKSIKYPETMHTKK
Download sequence
Identical sequences ENSDORP00000007010 ENSDORP00000007010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]