SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007043 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007043
Domain Number 1 Region: 457-706
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-57
Family Eukaryotic proteases 0.0000649
Further Details:      
 
Domain Number 2 Region: 190-272
Classification Level Classification E-value
Superfamily Kringle-like 2.34e-32
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 3 Region: 96-188
Classification Level Classification E-value
Superfamily Kringle-like 1.86e-30
Family Kringle modules 0.00024
Further Details:      
 
Domain Number 4 Region: 366-454
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-30
Family Kringle modules 0.00011
Further Details:      
 
Domain Number 5 Region: 44-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000000165
Family Hairpin loop containing domain 0.013
Further Details:      
 
Domain Number 6 Region: 324-365
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000118
Family Kringle modules 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007043   Gene: ENSDORG00000007508   Transcript: ENSDORT00000007509
Sequence length 708
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5448:98311:105074:-1 gene:ENSDORG00000007508 transcript:ENSDORT00000007509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLALLLLLMQCLGPLXXXXXXXXXXXXXXXXXXXXXHAVVPGPWQEDVANAEECARLC
GPLLDCRAFHYNRSSHGCQLLPWTQNSPNTQIHHSGCCDLFQKKDYIRTCIMDKGVGYRG
TVATTAGGLTCQSWNHRFPNDHRYTPTLQNGLEENFCRNPDGDSGGPWCYTTNPSVRFQS
CGIKSCQEAACVWCNGEDYRGSVDHTESGRECQRWDLQYPHQHPFHPGKFMERGLDDNYC
RNPDGSERPWCYTTDPQLEREFCAIPSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXDLRENFCRNPDGSEAPWCFTTRPGMRVAFCYQIPR
CTDEILPEDCYQGSGKQYRGSVNKTRKGIPCQHWSAETPHKPQFTPASAPQLEKNFCRNP
DGDSHGPWCYTTDPGTLFDYCALHCNKDQLPSILKPPVPVQFEKCGKRVDRMDRWRSMMR
VVGGQPGNSPWTVSLRNRKGEHFCGGSLVKEKWVLTARQCFSSCHEPLTGYEVWSGTLFQ
NPQPGEPDLQRVPIAKMVCGPSSSQLVLLKLARSVTLNQRVALICLPPERYVVPPRTKCE
IAGWGEGKGSSGASVLHVASMNVISNQECNVKHRGRVHENEMCTEGLLVPTGACEGDYGG
PLACFTHDCWVLQGIIIPNRVCARPRWPAIFMRVSVFVDWIQKVMQLE
Download sequence
Identical sequences ENSDORP00000007043 ENSDORP00000007043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]