SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007248 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007248
Domain Number 1 Region: 571-919
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-127
Family ALDH-like 0.0000000122
Further Details:      
 
Domain Number 2 Region: 141-194
Classification Level Classification E-value
Superfamily Formyltransferase 0.00000000000366
Family Formyltransferase 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007248   Gene: ENSDORG00000007732   Transcript: ENSDORT00000007733
Sequence length 920
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3025:5446:40011:-1 gene:ENSDORG00000007732 transcript:ENSDORT00000007733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRGSQALRRFSTGRVCFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEDTPVFFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXTLVMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPNDTVD
TLYNRFLFPEGIKAMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLMVRNLQFEDGKMIPASQYFSAGEMSVVELTAEEMKVAETIKVIWAGILSNVPMIE
DSTDFFKSGASSMDVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGSTIPINQARPNRNLTFTKKEPIGVCAIIIPWNYPLMMLAW
KSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQHLSEHPD
IRKLGFTGSTTIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAVFFN
KGENCIAAGRLFVEESIHDEFVTKVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYC
EAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFPNGDING
VLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSGFGK
DLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences ENSDORP00000007248 ENSDORP00000007248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]