SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007294 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007294
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 9.08e-86
Family Integrin A (or I) domain 0.000000196
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.48e-21
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 3 Region: 360-468
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000575
Family Integrin domains 0.0029
Further Details:      
 
Domain Number 4 Region: 596-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000156
Family Integrin beta EGF-like domains 0.005
Further Details:      
 
Domain Number 5 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Integrin beta EGF-like domains 0.004
Further Details:      
 
Domain Number 6 Region: 25-52
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000889
Family Plexin repeat 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007294
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.024
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007294   Gene: ENSDORG00000007780   Transcript: ENSDORT00000007780
Sequence length 786
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3913:15706:46502:-1 gene:ENSDORG00000007780 transcript:ENSDORT00000007780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQFIVWIGLISSACCVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNKLVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGR
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SGNSSNVIQLIIDAYNSLSSEVILENSKLPEGVMINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITXXXXXXXXXXXLKIKPLGFTEEVEIILHFICECECQNEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGICRCRVCECYPNYTGSACDCSLDTGPCT
AVNGQICNGRGICECGVCKCTDPKFQGQTCETCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNLTKVENRDKLPQPVQVYPVTHCKEKDVDDCWFYFTYSVNENNEAIVHVVET
PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTVKI
LFTRVL
Download sequence
Identical sequences ENSDORP00000007294 ENSDORP00000007294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]