SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007367 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007367
Domain Number 1 Region: 31-300
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.47e-99
Family Bee venom hyaluronidase 0.0000402
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007367
Domain Number - Region: 411-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00569
Family Integrin beta EGF-like domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007367   Gene: ENSDORG00000007857   Transcript: ENSDORT00000007857
Sequence length 434
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6814:49797:52038:-1 gene:ENSDORG00000007857 transcript:ENSDORT00000007857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTAQLLRICTLFLILLDLTQGSRGPVVTNKPFITVWNANTQPCLERYGVDVDVSVFDVVA
NPGQTFHGPNMTIFYSWQLGTYPYYTTTGEPVFGGLPQNASLYTHLTRAYWDIQAAIPVS
AFSGLAVIDWEAWRPLWAFNWDSKDIYRQRSRALVQTQHPDWPASQVEEAAKDQFQEAAQ
AWMAGTLQLGETLRPHGLWGFYGFPNCYNYDFQRANYTGQCSHYIRVQNNQLRWLWNQSR
ALYPSIYMPTELVGTKKAQLFVRHRVGEAFRVAATARAPHLPVLPYVQIFYNMTKLLPLX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYMDTTLGPFVLNVTSGALLCSQA
LCTGHGRCARRHSHPHAQLFFNPASFSIQLTQGGRPLTLKGTLSLEDHAQMAMQFKCRCY
QGWQGASCEQRDIW
Download sequence
Identical sequences ENSDORP00000007367 ENSDORP00000007367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]