SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007455 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007455
Domain Number 1 Region: 212-419,505-545
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-25
Family Kelch motif 0.0043
Further Details:      
 
Domain Number 2 Region: 37-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1438-1466,1524-1604,1697-1774
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-17
Family Kelch motif 0.019
Further Details:      
 
Domain Number 4 Region: 1144-1192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 5 Region: 1007-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000018
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 6 Region: 1096-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000188
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007455
Domain Number - Region: 2165-2215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 2093-2128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000371
Family EGF-like domain of nidogen-1 0.073
Further Details:      
 
Domain Number - Region: 2259-2294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00273
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 1231-1334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00785
Family Spermadhesin, CUB domain 0.0086
Further Details:      
 
Domain Number - Region: 2440-2450
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007455   Gene: ENSDORG00000007946   Transcript: ENSDORT00000007948
Sequence length 2756
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6232:17331:58130:1 gene:ENSDORG00000007946 transcript:ENSDORT00000007948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILGRALAAALAALAWAVLGPLSPRALAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEW
LIEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPQGPLLASLSGSTRPPPIEASSGKML
LHLFSDANYNLLGFNASFRFSLCPGGCQSHGQCQPSGVCVCEPGWGGPDCGLQECSTYCG
SHGTCASRLGPCRCERGFLGRACDLHLWENQGAGWWHNVSAGDPAFSARIGAAGAFLSPV
GLLAVFGGQDLNKALGDLVLYNFSANTWESWDLSPAPAARHSHVGVAWDGFLVLMGGELA
DGSLTNDVWAFSPFGKGRWKLLAPPSSSSSGPPGLAGHAAALVDDTWLYVSGGRTQHDLF
SSGLFRFHLDITGGGYWEQVIPAGGRPPAATGHSMVFHAPSRALLVHGGHRPSTARXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGD
LMAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTLLGPCPA
ASCLGLGRLLSDCQACLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEVGRWVAQQEKETRRLQRP
GSARLFPLPGRGHKYAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFLEPYRSS
ACTSYTSCLGCLADQGCGWCLSSATCHLRQGGARCEDDGAGGSLLVLVPALCPLCEEHRD
CHACTDLFCEWHQSSSRKGDAACSRRGRGRGALKSPEECPPLCSQRLTCEDCLANSSQCA
WCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCSGFLTCHECLQSHECGWCGNE
DNPTLGRCLQGDFSGPLGGGNCSLWVSQGLGLSVALPARWAYARCPDVDECRLGLARCHP
RATCLNTPLSYECHCQRGYQGDGVTHCNRTCLEDCGHGVCSGPPDFTCVCDLGWTSDLPP
PTPAPGPPAPRCSRDCGCNFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSFGNATGSGG
CRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCFRECGGRA
LLTNVSSVALGSRRFGGLLPPGGGAARAGPGLSYCVWVVSATEELQPCAPGTLCPPLTLT
FSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLH
WEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWAGPHCRMA
LCPENCNAHTGAGICNQSLGVCICAEGFGGPDCATKLDGGQLVWETVMDSRLSADTASRF
LHRLGHTMVAGPEGTLWMFGGLGLPQGLLGNLYXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGVTRDFWVLNLTTLQWRQEKAPQTVELPAVAGHSLTA
RRGLSLLLVGGYSPENGFNQQLFEYQLATGTWVSGAQSGTPPTXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNVGFCLRALGPVHRKQGPPQR
REMALPGNFLEEGPRPRLFHAAALLGDTMVVLGGRSDPDEFSSDVLLYQVNCNAWLLPDL
TRPASVGSPMEESVAHAVAAVGNRLYISGGFGGVALGRLLALTLPPDPCRLLPSLEACNQ
SEACTWCHGACLSGDQAHXXXXXXXXXXXXXXXXXXXXXXXXXXXCLARHPRTLQPGDGE
ASAPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREG
KCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVSPMPVESSPPLPCPTPCHLLPNCT
SCLDSKGADGGWQHCVWSSSLQQCLSPSYLPLRCMAGGCGRLLRGPESCSLGCAQATQCA
LCLRRPHCGWCAWGGQDGGGRCMEGGLSGPRDGLTCGRPGAAWAFLSCPPENECANGHHD
CNETQNCHDQPHGYECSCKTGYTMDNVTGLCRPVCAQGCVNGSCVEPDHCRCHFGFVGRN
CSTECHCNRHSECAGVGARDHCLLCRNHTKGSHCEQCLPLFVGSALGGGTCRPCHAFCRG
NSHVCVSRKELEMARREPEKYSLDPEEIENWVTEGPSEDEAVCVNCQNNSYGDKCESCLH
GYFLLDGKCTKCQCNGHADTCNEQDGTGCPCQNNTETGTCQGSSPSDRRDCYKYQCAKCR
ESFHGSPLGGQQCYRLISVEQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVD
IRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTGIHTVHIQPPLPPPPPPPPADGGPRAAAG
DSGGQGAGNGPSIPAEPRVREVWPRGLITYVTVTEPAAVLVVRGVRDRLVITYPHEHHAL
KSSRFYLLLLGVGDPSGPGANGSADSQGLLFFRQDQAHIDLFVFFSVFFSCFFLFLSLCV
LLWKAKQALDQRQEQRRHLQEMTKMASRPFAKVTVCFPPDPTAPAWKPTGLPPPAFRRSE
PFLAPLLLTGAGGPWGPMGGGCYPSAIPATTAGLRAGPITLEPTEDGMAGVATLLLQLPG
GPHAPNGACLGSALVTLRHRLHEYCGGSGGAAGSGHGAGAGRKGLLNQDNLTSMSL
Download sequence
Identical sequences ENSDORP00000007455 ENSDORP00000007455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]