SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007489 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007489
Domain Number 1 Region: 1171-1501
Classification Level Classification E-value
Superfamily NHL repeat 6.28e-27
Family NHL repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 1399-1644
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000157
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007489
Domain Number - Region: 714-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000184
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 618-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000218
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 684-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000436
Family Integrin beta EGF-like domains 0.037
Further Details:      
 
Domain Number - Region: 550-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000782
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 741-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 585-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00179
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 520-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 650-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family Integrin beta EGF-like domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007489   Gene: ENSDORG00000007981   Transcript: ENSDORT00000007983
Sequence length 2034
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5680:199134:468008:1 gene:ENSDORG00000007981 transcript:ENSDORT00000007983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKERRPYCSLTKSRREKERRYTNSSADNDECRVPTQKSYSSSETLKAFDHDSSRLLYG
NRVKDLVHREADEYSRQGQNFTLRQLGVCEPATRRGLAFCAEMGLPHRGYSISAGSDADT
ENEAVMSPEHAMRLWGRGVKSGRSSCLSSRSNSALTLTDTEHENKSDSDTEQPANTQGQS
TLQPLPPSHKQHSTQHHPSITSLNRNSLTNRRNQSPAPPAALPAELQTTPESVQLQDSWV
LGSNVPLESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXKLGGFTQENNTIDSGELDIGRRAVQEVPPGIFWRSQLFIDQPQFLKFNI
SLQKDALIGVYGRKGLPPSHTQYDVELLDGSRLIAREQRNLVESERAGRQARSVSLHEAG
FIQYLDSGIWHLAFYNDGKNPEQVSFNTIVIESVVECPRNCHGNGECVSGTCHCFPGFLG
PDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACN
SGYKGENCEEADCLDPGCSNHGVCIHGECHCNPGWGGSNCEILKTMCPDQCSGHGTYLQE
SGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEESWTGPACNQRACHPRCAEHGT
CKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVAMETLC
TDSKDNEGDGLIDCMDPDCCLQSSCQNQPFCRGLPDPQDIISQSLQSPSQQAAKSFYDRI
SFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLXXXXXXXXXXXXXXXXXXXXXX
XFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFYVMDTLVMKKEENDIPSCDLSGFVR
PNPIIVSSPLSTFFRSSPEDSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKIT
MTQSIIPFNLMKVHLMVAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSV
GYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQ
QPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSG
NVTSVLELSSNPAHRYYLATDPVTGDLYVSDTNTRRIYRPKSLTGAKDLTKNAEVVAGTG
EQCLPFDEARCGDGGKAVEATLMSPKGMAIDKNGLIYFVDGTMIRKVDPNGIISTLLGSN
DLTSARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDNNVVLQITENRQVRIAAGRP
MHCQVPGVEYPVGKHAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISLV
AGIPSECDCKNDANCDCYQSGDGYAKDAKLNAPSSLAASPDGTLYIADLGNIRIRAVSKN
KPLLNSMNFYEVASPADQELYIFDINGTHQYTVSLVTGDYLYNFSYSNDNDITAVTDSNG
NTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLATKS
DETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGDMDKAITVDIESSSREEDVSITSNLSSI
DSFYTMVQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLAGTANPTVAKRNMTLPGE
NGQNLVEWRFRKEQAQGRVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLLRIAY
DTSGHPTLWLPSSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFADGKTWS
YTYLEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPESN
ASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGVLKTVN
LQSDGFICTIRYRQIDPLIDRQIFRFSDGMDARFDYSYDNSFRVSMGVIETPLP
Download sequence
Identical sequences ENSDORP00000007489 ENSDORP00000007489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]