SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007500 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007500
Domain Number 1 Region: 46-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.69e-48
Family Glutathione peroxidase-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007500   Gene: ENSDORG00000007995   Transcript: ENSDORT00000007995
Sequence length 209
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4757:25849:29622:1 gene:ENSDORG00000007995 transcript:ENSDORT00000007995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLVAHPLKCSGPKAKMFAVLLSMILCTVMLFLLQLKFLKPKINSFYAFEVKDTKGRTV
SLEKFKGKVSLVVNVASNCQLTDRNYLALKELHREFGPYHFSVLAFPCNQFGQAEPRKSQ
EVESFARKNYGVTFPIFHKIKILGPEAEPAFRFLVDSSKKEPKWNFWKYLVNPEGQVVKF
WRPEEPVDAIKPLISQMVGQIIIKKKEDL
Download sequence
Identical sequences A0A1S3FDF9
ENSDORP00000007500 ENSDORP00000007500 XP_012874007.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]