SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007519 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007519
Domain Number 1 Region: 272-374
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.02e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 116-182
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000733
Family BphP N-terminal domain-like 0.064
Further Details:      
 
Domain Number 3 Region: 31-74
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000262
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007519   Gene: ENSDORG00000008014   Transcript: ENSDORT00000008014
Sequence length 784
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2533:69852:122654:-1 gene:ENSDORG00000008014 transcript:ENSDORT00000008014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKRRDQFNVLIKELGSML
PGNARKMDKSTVLQSIDFXXXXXXITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFF
LAIMTDGSIIYVSESVTSLLEQLPSDLVDQSLFNFIPEGEHSEVYKMLSTHLLESDSLTP
EYLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTSAHNGFEGTIQRTHR
PSYEERVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPF
EVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQW
NSRPEFIVCTHTVVXXXXXXXXXXXXXXXXXXXXXXXXXXSQDSGSDNRINTVSLKEALE
RFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMAQRRSSSSS
QSINSQSVGPSITQPVMSQPANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIH
RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNVQQLAPINMQSQVV
PTNQIQSGMNAGHIGTSQHMIQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYN
TMVISQPAAGSMVQIPSSMSQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAV
MVPSTMLMGQVVTAYPTFATQQQQAQALSVTQQQQQQSSQEQQLPPVQQPSQAQLTQPPQ
QFLQ
Download sequence
Identical sequences ENSDORP00000007519 ENSDORP00000007519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]