SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007621 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007621
Domain Number 1 Region: 51-279,376-418,460-539
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4e-34
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 573-648
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000806
Family WD40-repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007621   Gene: ENSDORG00000008122   Transcript: ENSDORT00000008122
Sequence length 649
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2460:107100:130398:-1 gene:ENSDORG00000008122 transcript:ENSDORT00000008122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFGAGKTKEVIFSMEEGSVKMFLRGRPVPMLIPEELAPTYSLDTRSELPSCRLKLDWV
YGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTI
ATGQVAGTTREGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVD
ESNDHVLSVWDWAKETKIMDGKCSTEAVLVATFHPTDPTLLITCGKSHIYFWSLEGGSLS
KRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXGHVEELWGLATHPSRAQFVTCGQDKQVHLWSSESHQPLWSRTIEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAYLAVGSH
DNLVYLYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQ
ITNADAVRNIEWATATCVLGFGVFGVWPEGADGTDINAVARSHNRKLLASADDFGKVSLF
SYPCCQPRALSHKYAGHSSHVTNVAFLWDDSLVLTTGGKDTSVLQWRVL
Download sequence
Identical sequences ENSDORP00000007621 ENSDORP00000007621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]