SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007902 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007902
Domain Number 1 Region: 23-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.55e-115
Family Transferrin 0.000000000316
Further Details:      
 
Domain Number 2 Region: 356-480
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.78e-36
Family Transferrin 0.00000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007902   Gene: ENSDORG00000008419   Transcript: ENSDORT00000008419
Sequence length 591
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_934:6036:18263:1 gene:ENSDORG00000008419 transcript:ENSDORT00000008419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAVGALLASAILGLGLATPEKTVRWCAVSDHEGSKCAAFRDIMKTVLPADGPQLACVK
KASSHDCIKAISGKEADAATVDGGLVYEAGLAPNNLKPVVVEFYGSAEKPQTDYYAVAVV
KKGTDFQMNQLQGKKSCHTGLGRSAGWNIPIGWLYCDLPEPRKPLEKAVANFFSGSCVPC
ADAAAFPKLCQLCPGCGCSSQNPYFGYVGAFKCLRDGGGDVAFIKHATIFEVLPDKADRD
QYELLCPDYTRRPVDKYEQCHLARVPSHAVVVRIVDSNEDLIWEILNVHEHFSKGKSKDF
DLFSSPHGKNLMFKDSAVGFLRVPPGMDYKLYLGHQYITTLRNQREGICPGGSEECKSVK
WCALSHHERLKCDQWSVNSGGVIECESAETPEDCIAKIVNGEADAMSTDGGYVYIAGQCG
LVPVLAENYKTQNCENPPEEVFGGCAPGYQENSTLCDLCIGPKKCAPNSKEGYHSYTGAF
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXNEFGSKVSDCSSKFCMFHSETKDLLFR
Download sequence
Identical sequences ENSDORP00000007902 ENSDORP00000007902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]