SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008611 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008611
Domain Number 1 Region: 29-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.13e-88
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008611   Gene: ENSDORG00000009167   Transcript: ENSDORT00000009167
Sequence length 277
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6790:62527:69833:1 gene:ENSDORG00000009167 transcript:ENSDORT00000009167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVMQPEGLGAGEGPFAGTGGGEYMEHEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKA
GTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLV
SIGAEEIVDGNLKMTLGMIWTIILRFATSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDG
LALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEK
AIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENE
Download sequence
Identical sequences ENSDORP00000008611 ENSDORP00000008611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]