SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008641 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008641
Domain Number 1 Region: 87-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.29e-62
Family Carbonic anhydrase 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008641   Gene: ENSDORG00000009201   Transcript: ENSDORT00000009199
Sequence length 284
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2724:2856:18933:1 gene:ENSDORG00000009201 transcript:ENSDORT00000009199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAFVALVSLIFLGVQAQHGADWTYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXQITLPPTMQLTAPDGAVYKATQMHYHWGGASYE
LSGSEHTIDGIRRVIEMHLVHYNAKYESYDVAKDKPDGLAVMAAFVEIEEYAENTHYSSL
ISHLANIRYPGQTTYLTDFDILDMLPGDMYHYYTYNGSLTTPPCTQNVRWFVMSDSVKIS
KAQVIKLENSVMNHQNQTLHNGYRKTQPLHSRVVEANFPYFPNT
Download sequence
Identical sequences ENSDORP00000008641 ENSDORP00000008641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]