SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008778 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008778
Domain Number 1 Region: 2741-2905
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-37
Family Laminin G-like module 0.0000000639
Further Details:      
 
Domain Number 2 Region: 2911-3092
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.54e-35
Family Laminin G-like module 0.0000000283
Further Details:      
 
Domain Number 3 Region: 2316-2503
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-30
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 2499-2690
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-26
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 5 Region: 2131-2307
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-23
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 812-864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1413-1464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 8 Region: 754-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 9 Region: 914-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 10 Region: 1470-1522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 11 Region: 284-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 12 Region: 1055-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 13 Region: 963-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 14 Region: 411-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family EGF-type module 0.075
Further Details:      
 
Domain Number 15 Region: 341-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 16 Region: 1829-2064
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000392
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008778
Domain Number - Region: 1114-1158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000237
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 481-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000865
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 1010-1052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 1667-1777,1808-1876
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0183
Family Apolipoprotein A-I 0.0081
Further Details:      
 
Domain Number - Region: 717-756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008778   Gene: ENSDORG00000009334   Transcript: ENSDORT00000009340
Sequence length 3094
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6337:2160:478489:1 gene:ENSDORG00000009334 transcript:ENSDORT00000009340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAAGVLLLLLLGDHGGGRAQGTSQRRQSQAHPQRGLFPAVLNLASNALITTNATCGER
GPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYKPWQYHAVTDTECTLYNI
YPRTGPPSYAQDDEVICTSFYKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRL
RFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATN
KSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKADECYYDENVARRN
LSLNIHGKYIGGGVCINCTQNTAGINCETCLDGFFRPKGVSPSYPMPCQPCHCDPAGSLS
EICVKDEKYALRGRAPGSCHCKTGFGGVGCDRCARGYTGYPECKPCNCSGLGSTNEDPCW
GPCSCKENVEGEDCSRCKSGFFNLQEDNQKGCDECFCSGVSNRCQSSYWTYGNVQGMRGW
SLTDISGHTQVAPHEDDPELPQQISISNMEARRALPDDYYWSAPAVYLGNKLLAVGGQLT
FTVSYDLEEEEEDTENALQLVVLLEGNDLRISTAQEEVYLQPSEEHINVITLKEESFIIH
GTNFPVSRRDFMTVLANLKRVLIQITYSFGMDAIFRLSSVNLESAVLYPTDGSVASSVEV
CQCPPGYSGSSCESCWPRHRRVNGTILGGLCEPCQCFGHAESCDDFTGECLNCKDHTGGP
YCNQCLPGFYGDPTQGSSEDCQPCACPLIISSNNFSPTCHLDRNLGLMCDQCPVGYAGSR
CERCAEGYFGQPSVPGGSCQPCQCNDNLDFSVPSCDSLSGSCLICKPGTXXXXXXXXXXX
XXXXXXXXXNCQPCRCNVNGSFSDICHRQTGQCECMPNVQGQRCDECKPQTFGLQSTRGC
VPCNCNSFGSKSFDCEENGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACDCSHLGNNCD
PTGQCICPPNTIGERCSTCAPYTWGHSIVTGCKACNCSSVGSLDFQCNVNTGQCNCHPKF
SGTKCTECNRGHWNYPHCSLCDCFLPGTDATTCDSETKKCFCSDQTGQCTCKVNVEGVHC
DRCRPGKFGLDAKDPLGCSSCYCFGVTSQCSEAKGLVLTWVMLQAEQIILPLVDEALQHT
TTKGITFLQPEIVADMDRVREDLHLEPFYWLPEQFEGKNXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEXXXXGFYRLRSEPGGRTGPTLGTCVPCQCHGHSSLCDPETSICQNCQHHTTGDF
CEQCALGYYGIVKGLPSDCQQCACPLISSSNNFSPSCIMEGLDDYRCTACPRGYEGQYCE
RCAPGYTGKRVRAGGSCAECECDPYGSLPVPGDLFTSLERCCPVYTRRKCDGGVCWYARS
GQECVFCGDECTGVLLGDLARLEQMAMNINLTGPLPAPYKILYGIENTTQELKYLLSPQR
APEKLIQLAEGNLNTLVMEMNELLNRATKVTADGEQTGQDAERTNSRAKSLEEFIKELVQ
DAEAVNEKAIQVNETLGSQDKAWERNLQELQKEIDQMMKELRKKNLDSKKEVAEEELVAA
ESLLKKMNKLFGEPRRKNEEMEKDLQEKLDDYKNKLDDAWDLLREATDKIREANYLSAAN
QRNMSALEKKKEAVESGKREIENTLKEGRDILDEATRLADEITSVIDYVEDIQTKLPPMS
EELKDKIDDLSQEIKDRNLAENVSRAERHAAQLNDSSAILDGILDEAKNISFNATAAFKA
YSNIKDYIDEAEKIANGAKALAQEATTLATSPQGLLKEDAKGSLQKSFKILNEAKKLAND
LKENDNRLNDLTTRLDNADVRNDDLLRAVNDTMGKLSAIPNDTASKLQAIKDKARQANDT
AKDVLAQIKQLHQNLDGLKQNYNKLADSVAKTNAVVKDPSRNSKIADADTTVKNLKQEAD
RLXDDLLFLELEISGDGRREINIKVSVSSGGDCIRTYKPEIKKGSYNNIIVNVKTAVADN
LLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIEASRTGRNG
SISVRALDGPKASMVPSTYHSASPPGYTILDVDANAMLFVGGLTGKIKKADAVRVITFTG
CMGETYFDSKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRPIRWYPNI
STVMFKFRTFSSSSLLMYLATRDLKDFMSVELSDGHIKVSYDLGSGIASVVSNQNHNDGK
WKSFTLSRIQKQANISIVDIDTNQEENIVTSSSGNNFGLDLKADDKIYFGGLPTLRNLRP
FIRPEVNVKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPKPGFVELPP
VPINVGTEINLSFSTKNESGIILLGSGGTVVPPRRKRRQTGQAYYAIFLNKGRLEVHLST
GTRTMRKIVVRPEPSLFHDGREHSVHMERTRGLFTVQVDEDKRHMQNLTVEQPIEVKKLF
IGGAPPEFQPSPLQNIPPFEGCVWNLVINSVPMDFARPVSFTNADIGRCADQKPLEEENG
VVPAEVVIQPQPVPTPALAHGPCAVESEPALLMRSKQFGLSRNSHIAIAFNETKVKNRLT
IELEVRTEADSGLLFYMARINHADFATVQLRDGFPYFSYDLGSGDTNTMIPTRINDGQWH
KIKIVRVKQEGILYVDNAANRTISPKKADILDVVGMLYVGGLPINYTTRRIGPVTYSIDG
CIRNLHMEEAPADLEQPTSSYHVGTCFAHAQKGTYFDGTGFAKAVGGFKVGLDLLVEFEF
RTTRTTGVLLGVSSQKMDGMGIEMVDEKLMFHVDNGAGRFTAIFDAGIPGSLCDGQWHRV
TAKKIKHRIELTVDGNQVDAQSPNPTSTSADTNDPVFVGGFPDGLNQFGLTTNVRFRGCI
RSLRLTKGTGKPLEVNFAKALELSGVQPVSCPTN
Download sequence
Identical sequences ENSDORP00000008778 ENSDORP00000008778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]