SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008804 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008804
Domain Number 1 Region: 154-273
Classification Level Classification E-value
Superfamily DNA clamp 1.76e-17
Family DNA polymerase processivity factor 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008804
Domain Number - Region: 36-101
Classification Level Classification E-value
Superfamily DNA clamp 0.027
Family DNA polymerase processivity factor 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008804   Gene: ENSDORG00000009368   Transcript: ENSDORT00000009367
Sequence length 281
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_239:257267:263030:-1 gene:ENSDORG00000009368 transcript:ENSDORT00000009367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLAQGLPDDEEQYCLVASLDNVRNLSTILKAIHFREYATCVATDNGIRVTVENAKCVQ
ANAFIQADIFREFMIKEESVTFRINFTVLLDCLSIFGSSSMPGTYTALRMCYQGYGHPLI
LFLEEGGVVTVCKINTQEPEETLDFDFSSTNVINKVILQSDGLREAFSELDMTSDVFQIT
MSPDKPYFRLSTFGNGGSSHLDYPKDSDLMEAFHCSQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEVSESES
Download sequence
Identical sequences A0A1S3FCS8
XP_012874065.1.60039 ENSDORP00000008804 ENSDORP00000008804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]