SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008928 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008928
Domain Number 1 Region: 430-736
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.23e-55
Family Eukaryotic proteases 0.00047
Further Details:      
 
Domain Number 2 Region: 127-238
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 3 Region: 296-366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 233-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000296
Family EGF-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008928   Gene: ENSDORG00000009499   Transcript: ENSDORT00000009504
Sequence length 736
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3868:39773:95310:-1 gene:ENSDORG00000009499 transcript:ENSDORT00000009504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELDRWTQLGLVFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEDNECDSCLIHPGCMIFENCKSCRNGSWGGTLDDFYVKGFYCAECRVGW
YGGDCMRCQVLRASKGQIMLESYTLNAHWKWTIHDKAWFIIQIRFSMLSLEFDYMCQYDY
VEIRDGDHRDSPIIKRFCGNERPAPIRSTGSSLHVLFHSDGSKNFDGFHAVFEEITACSS
SPCFHDGTCLLDATGSYKCACLAGYTGQHCESXXXXXXXXXXXXXXXXXXLEERNCSDLG
GPVNGYKKITGGPGLLNGRNAKIGTVVSFFCNNSYVLSGDEKRTCQQNGQWSGKQPICIK
ACREPKISDLVRRKVLPMQVQSRATPLHQLYSSAFSKQKLQDAATKKPALPFGDLPAGYQ
HLHTQLQYECISPFYRRLGSSRRTCLQTGKWSGRAPSCIPICGKIENITSPKIQGTRWPW
QAAIYRRTSGEPDGGLHKGAWFLVCSGALVNERTVVVAAHCVTDLGKVSIIKTADLKVVL
GKFYRDDDRDEKTIQNLRVAAIILHPNYDPILLDADIAILKLLDKARISTHVQPVCLAAT
RDLSISFQESHITVAGWNILADVRSPGFKNDTLRLGMVRVVDSLLCEEQHEDHGIPVSVT
DNMFCAIQDPSAPSDICTAETGGIAAMSFPGRASPEPRWHLVGLVSWSYDKTCNHHLSTA
FTKVLPFKDWVERNMK
Download sequence
Identical sequences ENSDORP00000008928 ENSDORP00000008928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]