SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008951 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008951
Domain Number 1 Region: 568-703
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-39
Family Mannose 6-phosphate receptor domain 0.00041
Further Details:      
 
Domain Number 2 Region: 273-408
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-37
Family Mannose 6-phosphate receptor domain 0.000000686
Further Details:      
 
Domain Number 3 Region: 1456-1587
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.1e-36
Family Mannose 6-phosphate receptor domain 0.000000154
Further Details:      
 
Domain Number 4 Region: 1309-1448
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-34
Family Mannose 6-phosphate receptor domain 0.00067
Further Details:      
 
Domain Number 5 Region: 1016-1158
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.19e-33
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 6 Region: 704-865
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-32
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 7 Region: 1163-1302
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.92e-32
Family Mannose 6-phosphate receptor domain 0.00016
Further Details:      
 
Domain Number 8 Region: 422-559
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.19e-31
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 9 Region: 1915-2066
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.23e-30
Family Mannose 6-phosphate receptor domain 0.00046
Further Details:      
 
Domain Number 10 Region: 1592-1737
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.66e-30
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 11 Region: 2073-2220
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-29
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 12 Region: 3-116
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.45e-28
Family Mannose 6-phosphate receptor domain 0.00000364
Further Details:      
 
Domain Number 13 Region: 120-208
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.1e-23
Family Mannose 6-phosphate receptor domain 0.00000871
Further Details:      
 
Domain Number 14 Region: 868-1017
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.19e-22
Family Mannose 6-phosphate receptor domain 0.0051
Further Details:      
 
Domain Number 15 Region: 1744-1837,1886-1928
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.06e-21
Family Mannose 6-phosphate receptor domain 0.0033
Further Details:      
 
Domain Number 16 Region: 1836-1884
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000146
Family Fibronectin type II module 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008951
Domain Number - Region: 246-273
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00118
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008951   Gene: ENSDORG00000009527   Transcript: ENSDORT00000009528
Sequence length 2430
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6379:16812:86464:1 gene:ENSDORG00000009527 transcript:ENSDORT00000009528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLWEAVDTQNSRVYKIKLCGDVEIVGCEPSSAVCMFDLKTRKYYSIGDSFLKSTSRSLLE
FNTTTACQHAGPGHQVQSTITFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDTFKAKK
EVPCYAFDAELKKHDLNPLIKLSGGYLVDDSDPDTSLFINVCRDIDSLRGSSPQLHACPT
GTAACLLRGNEGFDVGQPKDGLKLVSKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXSTIPKLTAKSNCRYEVEWITEYACHRDYLESGTCLLNSEQHDIAIDLRPLAQYYVA
DGKEYTFYMSVCGNTDVQICNNKEAAVCQVKKTDSTQVKISGRHQKYSDGDLTLIYFGGD
ECSSGFQRMSVINFECNKTAGNEGRGGPVFTGEVDCTYFFTWDTTYACVKEKEDLLCGSS
DGKKRYDLSVLARHSESEQNWEAVDGSQTETEKKYFFINVCHRVLREGKARSCPEDAAVC
AVDKTGSKNLGKFVSSPTKEKGNMRLSYSDGDDCADGKKITTNITLVCKPGDLESAPVLR
TSEDSGCFYEFEWYTAAACVRSKTEGENCTVVDAQAGFSFDLSPLTKKNGAYRVDTEKYD
FYINVCGAVSVESCQADSGACQVAKSDRKSWNLGLSNAKLSYYDGMIQLNYRDGTPYNNE
KHTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTMEQY
DLSSLVKSEGSHGGNWYAMDNAREHVTWRKYYINVCRPLNPVRGCDRYASACQMKYENDQ
GSLTEVVSISNLGVAKTGPVVEESGSLLLEYVNGSACTTSDGQLTTYSTRIHLVCGRGSL
NTHPIFTFNWECVVSFLWNTEAACPIQMITDTDQACSIRDPNSGFVFNLNPLNSSQGYVV
SGIGKTFVFNICGTVPACGTVGGKPAFGCEAETQTEDLKNLKPDRPVGFEKSLQLSTEGF
LTLTYKGSSPNDRGTAFIIRFICNDDKYPGTAKFLHQDIDSARGIRNTFEFETALACVPS
LVDCQVTDQAGNEYDLSALSTVRKPWTAVDTSADGKKRTFYLSVCNPLPYIPGCRGSAVG
SCLVSEDNSWNLGVVQISPQVAANGSLSILYVNGDKCGNQRYSTRIIFECAQTWGSPTFQ
LLDDCEYVFVWRTVEACPVVREEGDDCQVQDPRHGNLYNLKPLGLRDTIVSAGEYTYYFR
VCGKLTSSVCTTHDRAKVVSSCQEKQGQQGFQKVAGLFTQKLTYENGLLKMNFTGGDTCH
QVYQRSTTIFFYCDRTTQKPVFLKETSDCSYLFEWRTQYACPPFNVTECSFKDAAGNSFD
LSPLSRYSDNWEAVVRTGATEHYLINVCKSLAPQAAGSEPCPPEAAVCLLDGSTPVNLGR
VADGPQQRDGLTILKYTDGDLCPDKIRRKSTTIRFTCSESQVNSRPLFVSAVQDCEYTFS
WPTAVACPVKSNVHGDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGDNENC
APGVGACFGQTRISVGKASTRLSYVDQVLQLVYEDGSPCPSKSGLSYKSVISFVCRPEAG
PTNRPMLISLDKQTCTLFFSWHTPLACEQAIECSVRNGSSIIDLSPLIHRTGGYEAYDES
EDGDSDTNPDFYINICQPLNPMHGVPCPAGSAVCKVPVSGPPLDIGRVTGPPILNPVANE
IYLNFESSTPCLADKHFNYTSLIAFHCKRGISMGTPKLIRTSECDFVFEWETPIVCPDEV
KMDGCSLTDEQLLYSFNLSSLSKSTFKVTRDSRTYSVGVCAAAAGPEQGGCKDGGVCLLS
GSKGASFGRLASMQLDYRHQDEAVILSYVNGDACPPETDEGEPCVFPFIFNKKSYEECVL
ESRAKLWCSTTANYDRDLEWGFCRPTNSHRTSAIIFKCDENEDVGRPQVLSEVRGCEVTF
EWRTKVVCLPKKMECKFVHQHKTYDLRLLSSLTGSWYFVHEGASYFINLCQKVYKGPLGC
SERASICKKSASGQVQVLGLVHTQKLDVVDDKVVVTYSKGYACGENKTASSVIELTCAKT
VGRPAFKRFDIDSCTYYFRWDSRAACAVRPQEVHMVNGTLTNPVNGKSFSLGDIYFKLFS
ASGDMRTNGDNYLYEIQLSSITSSTNPACSGANICQVKPSDQHFSRKVGMADRTKYYVQD
GDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSHETADCQYLFSWYTAAVCP
LGVGFDSESAGLDRPEYKGLSERSQAVGAILSLLLAALTGCLLALLLHKKERRETVINKL
TNCCRRSSSVSYKYSKVNKEEETDENETEWLMEEIQLPAPGLGREGQENGHITTKSVKAE
ALTSLHGDDQDSEDEVLTIPEVKVHSGRESSQPRRNPPCKALREREDDRVGLVHSERARK
GKPRPGQQKTAGSSKLVSFHDDSDEDLLHI
Download sequence
Identical sequences ENSDORP00000008951 ENSDORP00000008951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]